Silkworm BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001516-TA|BGIBMGA001516-PA|undefined
         (63 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g01910.1 68418.m00110 hypothetical protein                          27   2.1  

>At5g01910.1 68418.m00110 hypothetical protein 
          Length = 165

 Score = 26.6 bits (56), Expect = 2.1
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 3  QDSDDTALAERVRGFKSDPEKVREATEFVDQLI 35
          + S D +LAE +  FK   E++RE  E  ++L+
Sbjct: 40 ETSIDASLAEELSAFKKKLERLREDRESTEKLL 72


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.312    0.129    0.347 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,095,676
Number of Sequences: 28952
Number of extensions: 22166
Number of successful extensions: 30
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 29
Number of HSP's gapped (non-prelim): 1
length of query: 63
length of database: 12,070,560
effective HSP length: 43
effective length of query: 20
effective length of database: 10,825,624
effective search space: 216512480
effective search space used: 216512480
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.8 bits)
S2: 51 (24.6 bits)