BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001516-TA|BGIBMGA001516-PA|undefined (63 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. 21 1.2 AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. 21 1.2 >AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 21.0 bits (42), Expect = 1.2 Identities = 11/32 (34%), Positives = 16/32 (50%) Query: 1 MRQDSDDTALAERVRGFKSDPEKVREATEFVD 32 +R+D + +A FK PE R T F+D Sbjct: 39 VRKDEVASGIAVMTAFFKKYPEYQRYFTAFMD 70 >AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 21.0 bits (42), Expect = 1.2 Identities = 11/32 (34%), Positives = 16/32 (50%) Query: 1 MRQDSDDTALAERVRGFKSDPEKVREATEFVD 32 +R+D + +A FK PE R T F+D Sbjct: 39 VRKDEVASGIAVMTAFFKKYPEYQRYFTAFMD 70 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.312 0.129 0.347 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,159 Number of Sequences: 429 Number of extensions: 187 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 63 length of database: 140,377 effective HSP length: 43 effective length of query: 20 effective length of database: 121,930 effective search space: 2438600 effective search space used: 2438600 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 35 (18.7 bits) S2: 35 (18.2 bits)
- SilkBase 1999-2023 -