BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001514-TA|BGIBMGA001514-PA|undefined (77 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-76|ABI31125.1| 80|Drosophila melanogaster CG34112-PA ... 27 4.2 AE014297-2422|AAF55479.3| 2938|Drosophila melanogaster CG33547-P... 25 9.6 >AE014297-76|ABI31125.1| 80|Drosophila melanogaster CG34112-PA protein. Length = 80 Score = 26.6 bits (56), Expect = 4.2 Identities = 13/34 (38%), Positives = 18/34 (52%) Query: 7 RAQARKRGAADPTLGDGGADLPLRADFTAPPHLT 40 R++ +KR A D DGG+ DF P+LT Sbjct: 45 RSKNKKRDAVDGKFFDGGSGSGSLQDFEKSPYLT 78 >AE014297-2422|AAF55479.3| 2938|Drosophila melanogaster CG33547-PA protein. Length = 2938 Score = 25.4 bits (53), Expect = 9.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Query: 4 DWGRAQARKRGAADPTLGDGGAD 26 DW R +A ++G+ D D G D Sbjct: 821 DWSRWEAERQGSQDSATKDSGID 843 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.322 0.137 0.448 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,208,786 Number of Sequences: 52641 Number of extensions: 78290 Number of successful extensions: 141 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 139 Number of HSP's gapped (non-prelim): 2 length of query: 77 length of database: 24,830,863 effective HSP length: 57 effective length of query: 20 effective length of database: 21,830,326 effective search space: 436606520 effective search space used: 436606520 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -