BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001514-TA|BGIBMGA001514-PA|undefined (77 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15920.1 68416.m02013 phox (PX) domain-containing protein wea... 27 2.0 At3g60520.1 68416.m06769 expressed protein 25 4.6 >At3g15920.1 68416.m02013 phox (PX) domain-containing protein weak similarity to myosin heavy chain [Rana catesbeiana] GI:4249699; contains Pfam profile PF00787: PX domain Length = 755 Score = 26.6 bits (56), Expect = 2.0 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Query: 6 GRAQARKRGAADPTLGDGGADLPLRADFTAPP-HLTALNSV 45 GR A+ P DG + LPL D+++PP HL ++V Sbjct: 56 GREPDTDSRASPPHRHDGRSPLPLGMDWSSPPRHLEGRDTV 96 >At3g60520.1 68416.m06769 expressed protein Length = 129 Score = 25.4 bits (53), Expect = 4.6 Identities = 9/35 (25%), Positives = 19/35 (54%) Query: 4 DWGRAQARKRGAADPTLGDGGADLPLRADFTAPPH 38 DW + +A+ R A + G + R+++++P H Sbjct: 51 DWCQCEAKSRTGAKHGVNGGSSKRSYRSEYSSPHH 85 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.322 0.137 0.448 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,523,363 Number of Sequences: 28952 Number of extensions: 35756 Number of successful extensions: 45 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 43 Number of HSP's gapped (non-prelim): 2 length of query: 77 length of database: 12,070,560 effective HSP length: 57 effective length of query: 20 effective length of database: 10,420,296 effective search space: 208405920 effective search space used: 208405920 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 51 (24.6 bits)
- SilkBase 1999-2023 -