BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001510-TA|BGIBMGA001510-PA|IPR001412|Aminoacyl-tRNA synthetase, class I, IPR005113|uDENN, IPR001194|DENN, IPR005112|dDENN, IPR002885|Pentatricopeptide repeat (1604 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 24 7.3 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 24.2 bits (50), Expect = 7.3 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 5/51 (9%) Query: 165 NRPPLISYKPDVLFRYPVTDRRSLAFPPSVPLFCLPMGATLELWPNNAASP 215 NR P +KP VL ++P S +P F + A L P +SP Sbjct: 262 NRKPRTDFKPQVLPQWP-----SPIGASHLPYFAAAVAAASNLSPKTNSSP 307 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 335,497 Number of Sequences: 317 Number of extensions: 13558 Number of successful extensions: 20 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 20 Number of HSP's gapped (non-prelim): 2 length of query: 1604 length of database: 114,650 effective HSP length: 66 effective length of query: 1538 effective length of database: 93,728 effective search space: 144153664 effective search space used: 144153664 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -