BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001510-TA|BGIBMGA001510-PA|IPR001412|Aminoacyl-tRNA
synthetase, class I, IPR005113|uDENN, IPR001194|DENN, IPR005112|dDENN,
IPR002885|Pentatricopeptide repeat
(1604 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 24 7.3
>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
protein protein.
Length = 1156
Score = 24.2 bits (50), Expect = 7.3
Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 5/51 (9%)
Query: 165 NRPPLISYKPDVLFRYPVTDRRSLAFPPSVPLFCLPMGATLELWPNNAASP 215
NR P +KP VL ++P S +P F + A L P +SP
Sbjct: 262 NRKPRTDFKPQVLPQWP-----SPIGASHLPYFAAAVAAASNLSPKTNSSP 307
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.319 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 335,497
Number of Sequences: 317
Number of extensions: 13558
Number of successful extensions: 20
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 20
Number of HSP's gapped (non-prelim): 2
length of query: 1604
length of database: 114,650
effective HSP length: 66
effective length of query: 1538
effective length of database: 93,728
effective search space: 144153664
effective search space used: 144153664
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 49 (23.8 bits)
- SilkBase 1999-2023 -