SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001510-TA|BGIBMGA001510-PA|IPR001412|Aminoacyl-tRNA
synthetase, class I, IPR005113|uDENN, IPR001194|DENN, IPR005112|dDENN,
IPR002885|Pentatricopeptide repeat
         (1604 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    24   7.3  

>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 24.2 bits (50), Expect = 7.3
 Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 5/51 (9%)

Query: 165 NRPPLISYKPDVLFRYPVTDRRSLAFPPSVPLFCLPMGATLELWPNNAASP 215
           NR P   +KP VL ++P     S      +P F   + A   L P   +SP
Sbjct: 262 NRKPRTDFKPQVLPQWP-----SPIGASHLPYFAAAVAAASNLSPKTNSSP 307


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.319    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 335,497
Number of Sequences: 317
Number of extensions: 13558
Number of successful extensions: 20
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 20
Number of HSP's gapped (non-prelim): 2
length of query: 1604
length of database: 114,650
effective HSP length: 66
effective length of query: 1538
effective length of database: 93,728
effective search space: 144153664
effective search space used: 144153664
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 49 (23.8 bits)

- SilkBase 1999-2023 -