BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001510-TA|BGIBMGA001510-PA|IPR001412|Aminoacyl-tRNA synthetase, class I, IPR005113|uDENN, IPR001194|DENN, IPR005112|dDENN, IPR002885|Pentatricopeptide repeat (1604 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 26 9.2 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 25.8 bits (54), Expect = 9.2 Identities = 23/87 (26%), Positives = 36/87 (41%), Gaps = 3/87 (3%) Query: 1144 VPAGTVSSSLVSLGNTLKLNFGPTSMAGKKSNELLQSGLSSLKSAATSMAKKFDEMKEVI 1203 V G S G+T+ N +S +GKKS+ SG +S K T + + + Sbjct: 947 VGGGGGGGSAGGAGSTISNNTNSSSSSGKKSS---HSGTNSSKRKKTVSPGEKKDRGGPM 1003 Query: 1204 SANSTPVKGAIGTATSALGAFRADDDG 1230 +A P AI + GA + +G Sbjct: 1004 AAGGPPSATAISYGLTMAGAAGSVSNG 1030 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.319 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,485,434 Number of Sequences: 2123 Number of extensions: 58032 Number of successful extensions: 79 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 79 Number of HSP's gapped (non-prelim): 2 length of query: 1604 length of database: 516,269 effective HSP length: 73 effective length of query: 1531 effective length of database: 361,290 effective search space: 553134990 effective search space used: 553134990 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -