BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001508-TA|BGIBMGA001508-PA|IPR000734|Lipase, IPR013818|Lipase, N-terminal (329 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 27 0.25 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 22 7.1 AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 22 7.1 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 22 7.1 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 26.6 bits (56), Expect = 0.25 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Query: 199 PAGPLWNTNSNRLNAR-DGVYV--EAIHTDGSTTGLGI 233 P G LWN N+ RL + D Y E I +G +GL I Sbjct: 825 PIGILWNINNKRLEPKGDNRYTIREEILANGVLSGLSI 862 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 21.8 bits (44), Expect = 7.1 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Query: 100 NNPTVV-IAHGWLSNQNTDINPTIRDAYLGKSDVNVIVLD 138 N PT IA+G L + + N + D G DV+++ +D Sbjct: 2 NEPTAAAIAYG-LDKKGAEQNILVYDLGGGTFDVSILTID 40 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/20 (45%), Positives = 15/20 (75%) Query: 118 INPTIRDAYLGKSDVNVIVL 137 ++ ++DA +GKS V+ IVL Sbjct: 145 VDKVLQDAKIGKSAVHEIVL 164 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/20 (45%), Positives = 15/20 (75%) Query: 118 INPTIRDAYLGKSDVNVIVL 137 ++ ++DA +GKS V+ IVL Sbjct: 145 VDKVLQDAKIGKSAVHEIVL 164 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.133 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,185 Number of Sequences: 317 Number of extensions: 3673 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 4 length of query: 329 length of database: 114,650 effective HSP length: 57 effective length of query: 272 effective length of database: 96,581 effective search space: 26270032 effective search space used: 26270032 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -