GeneModel BLAST Result against celegans

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001508-TA|BGIBMGA001508-PA|IPR000734|Lipase,
IPR013818|Lipase, N-terminal
         (329 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U13642-4|AAG00043.2|  687|Caenorhabditis elegans Hypothetical pr...    32   0.64 

>U13642-4|AAG00043.2|  687|Caenorhabditis elegans Hypothetical
           protein ZC395.8 protein.
          Length = 687

 Score = 31.9 bits (69), Expect = 0.64
 Identities = 19/68 (27%), Positives = 31/68 (45%)

Query: 64  NPANNQYLLFTRRNRRSSQTLTINNANSVTRSNFNANNPTVVIAHGWLSNQNTDINPTIR 123
           NP N     F +RN+R   +    N+  V+R+N+N N+ T   +       ++  N   R
Sbjct: 614 NPRNYSNRSFHQRNQRGHSSSNRFNSPFVSRNNYNNNSETTEGSSRRSEYNSSSSNHHSR 673

Query: 124 DAYLGKSD 131
            +Y G  D
Sbjct: 674 SSYRGNRD 681


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.318    0.133    0.403 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,537,439
Number of Sequences: 27539
Number of extensions: 378951
Number of successful extensions: 879
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 878
Number of HSP's gapped (non-prelim): 1
length of query: 329
length of database: 12,573,161
effective HSP length: 82
effective length of query: 247
effective length of database: 10,314,963
effective search space: 2547795861
effective search space used: 2547795861
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 60 (28.3 bits)