BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001507-TA|BGIBMGA001507-PA|IPR000734|Lipase, IPR013818|Lipase, N-terminal (342 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 2.9 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 8.9 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 2.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Query: 214 GLDPAGPLWNRNSGRIAP 231 G P G LWN N+ R+ P Sbjct: 802 GEKPIGILWNMNNKRLDP 819 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.8 bits (44), Expect = 8.9 Identities = 10/30 (33%), Positives = 17/30 (56%) Query: 78 LLYTRRNPTSPQTLVMNNANSITSSNFNRN 107 +L T + ++ T+ NAN+ S+N N N Sbjct: 215 VLETCQRNSNNSTITAGNANTNASNNNNNN 244 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.135 0.410 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,165 Number of Sequences: 429 Number of extensions: 4667 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 2 length of query: 342 length of database: 140,377 effective HSP length: 58 effective length of query: 284 effective length of database: 115,495 effective search space: 32800580 effective search space used: 32800580 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -