Silkworm BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001506-TA|BGIBMGA001506-PA|IPR013818|Lipase, N-terminal,
IPR000734|Lipase, IPR002035|von Willebrand factor, type A
         (293 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    33   0.002

>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
           adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 33.5 bits (73), Expect = 0.002
 Identities = 20/41 (48%), Positives = 22/41 (53%), Gaps = 3/41 (7%)

Query: 186 GLDPAGPLWNTNSNRLRP-GDGVYV--EAIHTDGSTSGLGI 223
           G  P G LWN N+ RL P GD  Y   E I  +G  SGL I
Sbjct: 822 GEKPIGILWNINNKRLEPKGDNRYTIREEILANGVLSGLSI 862


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.318    0.134    0.411 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 65,771
Number of Sequences: 317
Number of extensions: 2522
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 293
length of database: 114,650
effective HSP length: 56
effective length of query: 237
effective length of database: 96,898
effective search space: 22964826
effective search space used: 22964826
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 43 (21.4 bits)