BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001505-TA|BGIBMGA001505-PA|undefined (193 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 27 0.12 DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. 21 5.8 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 5.8 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 27.1 bits (57), Expect = 0.12 Identities = 9/21 (42%), Positives = 15/21 (71%) Query: 153 SSRIAEAAFLCKWYEMDQKSK 173 SS + EAA+ C WY+ +++K Sbjct: 184 SSSVMEAAYSCHWYDGSEEAK 204 >DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. Length = 135 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/11 (63%), Positives = 9/11 (81%) Query: 67 APCICIGVLSV 77 A CIC+G LS+ Sbjct: 9 AICICVGALSI 19 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/31 (32%), Positives = 14/31 (45%) Query: 60 FLELTQLAPCICIGVLSVLKILALTAKRQKI 90 F + + PC+ I LSVL +KI Sbjct: 237 FYTVNLIVPCVSISYLSVLAFYLPADSGEKI 267 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.328 0.142 0.417 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,138 Number of Sequences: 429 Number of extensions: 1874 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 3 length of query: 193 length of database: 140,377 effective HSP length: 54 effective length of query: 139 effective length of database: 117,211 effective search space: 16292329 effective search space used: 16292329 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.7 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -