BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001504-TA|BGIBMGA001504-PA|IPR002557|Chitin binding Peritrophin-A (342 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29615-1|AAC50246.1| 466|Homo sapiens chitotriosidase precursor... 35 0.36 BC105682-1|AAI05683.1| 466|Homo sapiens chitinase 1 (chitotrios... 35 0.36 BC105681-1|AAI05682.1| 466|Homo sapiens chitinase 1 (chitotrios... 35 0.36 BC105680-1|AAI05681.1| 466|Homo sapiens chitinase 1 (chitotrios... 35 0.36 BC069614-1|AAH69614.1| 454|Homo sapiens CHIT1 protein protein. 35 0.36 BC103695-1|AAI03696.1| 466|Homo sapiens chitinase 1 (chitotrios... 35 0.48 >U29615-1|AAC50246.1| 466|Homo sapiens chitotriosidase precursor protein. Length = 466 Score = 35.1 bits (77), Expect = 0.36 Identities = 15/42 (35%), Positives = 21/42 (50%) Query: 49 SDGILVAHEHCTRFYKCAEGRPVALKCPPNLLFNPSNEQCDW 90 +DG+ + FY CA GR CP L+F+ S + C W Sbjct: 424 ADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 465 >BC105682-1|AAI05683.1| 466|Homo sapiens chitinase 1 (chitotriosidase) protein. Length = 466 Score = 35.1 bits (77), Expect = 0.36 Identities = 15/42 (35%), Positives = 21/42 (50%) Query: 49 SDGILVAHEHCTRFYKCAEGRPVALKCPPNLLFNPSNEQCDW 90 +DG+ + FY CA GR CP L+F+ S + C W Sbjct: 424 ADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 465 >BC105681-1|AAI05682.1| 466|Homo sapiens chitinase 1 (chitotriosidase) protein. Length = 466 Score = 35.1 bits (77), Expect = 0.36 Identities = 15/42 (35%), Positives = 21/42 (50%) Query: 49 SDGILVAHEHCTRFYKCAEGRPVALKCPPNLLFNPSNEQCDW 90 +DG+ + FY CA GR CP L+F+ S + C W Sbjct: 424 ADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 465 >BC105680-1|AAI05681.1| 466|Homo sapiens chitinase 1 (chitotriosidase) protein. Length = 466 Score = 35.1 bits (77), Expect = 0.36 Identities = 15/42 (35%), Positives = 21/42 (50%) Query: 49 SDGILVAHEHCTRFYKCAEGRPVALKCPPNLLFNPSNEQCDW 90 +DG+ + FY CA GR CP L+F+ S + C W Sbjct: 424 ADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 465 >BC069614-1|AAH69614.1| 454|Homo sapiens CHIT1 protein protein. Length = 454 Score = 35.1 bits (77), Expect = 0.36 Identities = 15/42 (35%), Positives = 21/42 (50%) Query: 49 SDGILVAHEHCTRFYKCAEGRPVALKCPPNLLFNPSNEQCDW 90 +DG+ + FY CA GR CP L+F+ S + C W Sbjct: 412 ADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 453 >BC103695-1|AAI03696.1| 466|Homo sapiens chitinase 1 (chitotriosidase) protein. Length = 466 Score = 34.7 bits (76), Expect = 0.48 Identities = 15/42 (35%), Positives = 21/42 (50%) Query: 49 SDGILVAHEHCTRFYKCAEGRPVALKCPPNLLFNPSNEQCDW 90 +DG+ + FY CA GR CP L+F+ S + C W Sbjct: 424 ADGLYPNPRERSSFYSCAGGRLFQQSCPTGLVFSNSCKCCTW 465 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.320 0.136 0.454 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 44,525,628 Number of Sequences: 224733 Number of extensions: 1600640 Number of successful extensions: 2514 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2496 Number of HSP's gapped (non-prelim): 18 length of query: 342 length of database: 73,234,838 effective HSP length: 90 effective length of query: 252 effective length of database: 53,008,868 effective search space: 13358234736 effective search space used: 13358234736 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 66 (30.7 bits)
- SilkBase 1999-2023 -