BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001501-TA|BGIBMGA001501-PA|IPR001377|Ribosomal protein S6e (253 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 24 4.9 AF457564-1|AAL68794.1| 91|Anopheles gambiae hypothetical prote... 24 4.9 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 23.8 bits (49), Expect = 4.9 Identities = 13/36 (36%), Positives = 16/36 (44%) Query: 114 VRKGAQEIPGLTDGTVPRRLGPKRASKIRKLFNLSK 149 V GAQ++ G G P + PK IR SK Sbjct: 199 VYTGAQKVLGAPPGITPISISPKALDVIRNRRTKSK 234 >AF457564-1|AAL68794.1| 91|Anopheles gambiae hypothetical protein 17 protein. Length = 91 Score = 23.8 bits (49), Expect = 4.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Query: 109 LALVIVRKGAQEIPGLTDGTVPRRLGPKRAS 139 L L I GA +PG T T+ R KRA+ Sbjct: 34 LLLFIAPTGADPLPGQTQRTLGYRGNDKRAT 64 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.317 0.135 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,725 Number of Sequences: 2123 Number of extensions: 7303 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 2 length of query: 253 length of database: 516,269 effective HSP length: 63 effective length of query: 190 effective length of database: 382,520 effective search space: 72678800 effective search space used: 72678800 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -