BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001500-TA|BGIBMGA001500-PA|IPR002171|Ribosomal protein L2, IPR008991|Translation protein SH3-like, IPR008994|Nucleic acid-binding, OB-fold (280 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0077 + 16284106-16284128,16284552-16284795,16285490-162855... 28 7.3 04_04_1358 + 32869222-32869306,32869947-32870008,32870301-328703... 28 9.6 >06_03_0077 + 16284106-16284128,16284552-16284795,16285490-16285591, 16286347-16287057 Length = 359 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/37 (29%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Query: 235 GNRPRSGLWQRKSGRHGRKIKPPKPVKQICNPTSTKL 271 G+ P +WQ + RH ++PP+ ++ +P +T+L Sbjct: 116 GDDPYGSVWQAQGARHQVLVRPPRSPRE--DPMATQL 150 >04_04_1358 + 32869222-32869306,32869947-32870008,32870301-32870393, 32870640-32870761,32873139-32873167,32873586-32873891, 32873977-32874035,32874148-32874279,32874414-32874455, 32874560-32875093,32875189-32875379,32875538-32876027, 32876273-32876335,32876704-32876805,32876895-32877215, 32877294-32877386,32877484-32877585,32877718-32877822, 32877933-32878066,32878429-32878612,32879226-32879357, 32879447-32879559,32879628-32879709,32880328-32881992 Length = 1746 Score = 27.9 bits (59), Expect = 9.6 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 236 NRPRSGLWQRKSGRHGRKIKPPKPVKQICNP 266 N+PR G + KS +H R PP P +P Sbjct: 158 NKPRDGA-KHKSSKHARPATPPSPPALAASP 187 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.319 0.138 0.429 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,373,771 Number of Sequences: 37544 Number of extensions: 415371 Number of successful extensions: 770 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 770 Number of HSP's gapped (non-prelim): 2 length of query: 280 length of database: 14,793,348 effective HSP length: 81 effective length of query: 199 effective length of database: 11,752,284 effective search space: 2338704516 effective search space used: 2338704516 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -