BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001500-TA|BGIBMGA001500-PA|IPR002171|Ribosomal protein L2, IPR008991|Translation protein SH3-like, IPR008994|Nucleic acid-binding, OB-fold (280 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 7.8 AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 21 7.8 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 14 SASKPNIEKPKPGFGKSYR 32 S+S E+P+PG G Y+ Sbjct: 100 SSSDSEDERPRPGGGTKYQ 118 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/32 (28%), Positives = 18/32 (56%) Query: 15 ASKPNIEKPKPGFGKSYRRIVHFPEQYTVKPL 46 AS + P+P F +++ +V F + + + PL Sbjct: 17 ASDAVLAYPQPSFHQTFSFVVIFGQFFGIMPL 48 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.319 0.138 0.429 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 69,667 Number of Sequences: 317 Number of extensions: 3065 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 280 length of database: 114,650 effective HSP length: 56 effective length of query: 224 effective length of database: 96,898 effective search space: 21705152 effective search space used: 21705152 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -