BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001498-TA|BGIBMGA001498-PA|IPR005988|Synaptic vesicle protein SV2, IPR005829|Sugar transporter superfamily, IPR007114|Major facilitator superfamily, IPR011701|Major facilitator superfamily MFS_1 (556 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 26 2.3 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 24 9.3 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 26.2 bits (55), Expect = 2.3 Identities = 16/58 (27%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Query: 36 PSVKKSKSDPEKGSNSEKADFERAIELTGYGRF-HYMLLAVCGLVSTSEEMDVISMSF 92 PS + K P N AIEL GRF H ++ + E++ I +F Sbjct: 35 PSASQPKQKPAPAFNPRAGRMPNAIELESIGRFKHAEMMPILRETVKKEDVQRIRTNF 92 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 24.2 bits (50), Expect = 9.3 Identities = 8/26 (30%), Positives = 17/26 (65%) Query: 284 TGRSKDEYPVKQILVDDLVHAKPEKQ 309 +G+S Y ++ +L D+ H +PE++ Sbjct: 36 SGKSNFFYAIQFVLSDEFTHLRPEQR 61 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.323 0.137 0.411 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 540,872 Number of Sequences: 2123 Number of extensions: 20742 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 27 Number of HSP's gapped (non-prelim): 2 length of query: 556 length of database: 516,269 effective HSP length: 67 effective length of query: 489 effective length of database: 374,028 effective search space: 182899692 effective search space used: 182899692 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -