BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001494-TA|BGIBMGA001494-PA|IPR005033|YEATS, IPR002052|N-6 Adenine-specific DNA methylase (979 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 26 1.1 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 26 1.1 AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochr... 24 4.4 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 26.2 bits (55), Expect = 1.1 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Query: 65 TAISVASLLTENLLSHPFIVLRRQCQVHNNLRNY-HIVPYTLLPVVV 110 T S+ ++ ++ SHP I +QC +N Y H + Y L +V+ Sbjct: 180 TLCSIPQMVVFHVESHPNITWYQQCVTYNVFPTYAHELTYLLFGMVM 226 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 26.2 bits (55), Expect = 1.1 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Query: 65 TAISVASLLTENLLSHPFIVLRRQCQVHNNLRNY-HIVPYTLLPVVV 110 T S+ ++ ++ SHP I +QC +N Y H + Y L +V+ Sbjct: 180 TLCSIPQMVVFHVESHPNITWYQQCVTYNVFPTYAHELTYLLFGMVM 226 >AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q1 protein. Length = 126 Score = 24.2 bits (50), Expect = 4.4 Identities = 7/30 (23%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Query: 425 VPMRNSSFVNLFGPPIHKPAKVSPDPKKIE 454 +P +++ ++++ +H+ A + PDP+K++ Sbjct: 81 LPKESNAIIHIYD--VHRNADIYPDPEKLD 108 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.315 0.134 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,687 Number of Sequences: 317 Number of extensions: 7837 Number of successful extensions: 33 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 33 Number of HSP's gapped (non-prelim): 3 length of query: 979 length of database: 114,650 effective HSP length: 63 effective length of query: 916 effective length of database: 94,679 effective search space: 86725964 effective search space used: 86725964 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -