BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001493-TA|BGIBMGA001493-PA|IPR002035|von Willebrand factor, type A, IPR013608|VWA N-terminal, IPR004010|Cache (1174 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein pr... 26 1.7 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 26 1.7 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 24 5.3 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 24 5.3 >AY490815-1|AAR82970.1| 136|Tribolium castaneum glass protein protein. Length = 136 Score = 25.8 bits (54), Expect = 1.7 Identities = 22/91 (24%), Positives = 34/91 (37%), Gaps = 2/91 (2%) Query: 786 SREAEVLHFIRRRSDEPNFAMKKLNHIFSPIPPLLLE-KTYQCDEGLMARLCKDAIATDK 844 S+ A + +R S E F + FS + +T+ + RLCK A + Sbjct: 32 SQAANLTAHVRTHSGEKPFRCPVCDRRFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSS 91 Query: 845 WAREHEHPHRARDCSTCELGSITTFFASENL 875 +H H C+L + F S NL Sbjct: 92 TLTKHLRIHSGEKPYECKL-CLLRFSQSGNL 121 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 25.8 bits (54), Expect = 1.7 Identities = 22/91 (24%), Positives = 34/91 (37%), Gaps = 2/91 (2%) Query: 786 SREAEVLHFIRRRSDEPNFAMKKLNHIFSPIPPLLLE-KTYQCDEGLMARLCKDAIATDK 844 S+ A + +R S E F + FS + +T+ + RLCK A + Sbjct: 288 SQAANLTAHVRTHSGEKPFRCPVCDRRFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSS 347 Query: 845 WAREHEHPHRARDCSTCELGSITTFFASENL 875 +H H C+L + F S NL Sbjct: 348 TLTKHLRIHSGEKPYECKL-CLLRFSQSGNL 377 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 24.2 bits (50), Expect = 5.3 Identities = 14/41 (34%), Positives = 18/41 (43%) Query: 868 TFFASENLTLGSNIYREHVPVSQQWLTAARALTSPDKGIIG 908 TF S NLT+ +PVS + L + A D IG Sbjct: 125 TFHTSSNLTVSGLRCVNGIPVSSKTLASQSAYVQQDDLFIG 165 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 24.2 bits (50), Expect = 5.3 Identities = 14/41 (34%), Positives = 18/41 (43%) Query: 868 TFFASENLTLGSNIYREHVPVSQQWLTAARALTSPDKGIIG 908 TF S NLT+ +PVS + L + A D IG Sbjct: 125 TFHTSSNLTVSGLRCVNGIPVSSKTLASQSAYVQQDDLFIG 165 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.135 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 255,429 Number of Sequences: 317 Number of extensions: 10864 Number of successful extensions: 18 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 4 length of query: 1174 length of database: 114,650 effective HSP length: 64 effective length of query: 1110 effective length of database: 94,362 effective search space: 104741820 effective search space used: 104741820 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -