BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001492-TA|BGIBMGA001492-PA|IPR001965|Zinc finger, PHD-type, IPR011011|Zinc finger, FYVE/PHD-type, IPR012294|Transcription factor TFIID, C-terminal/DNA glycosylase, N-terminal (209 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77250.1 68414.m08997 PHD finger family protein contains Pfam... 43 1e-04 At5g46660.1 68418.m05749 CHP-rich zinc finger protein, putative ... 38 0.007 At3g01460.1 68416.m00070 PHD finger family protein / methyl-CpG ... 38 0.007 At2g25170.1 68415.m03010 chromatin remodeling factor CHD3 (PICKL... 37 0.011 At5g63900.1 68418.m08023 PHD finger family protein contains Pfam... 36 0.015 At5g55770.1 68418.m06951 DC1 domain-containing protein contains ... 36 0.015 At5g24330.1 68418.m02867 PHD finger family protein / SET domain-... 36 0.015 At1g79350.1 68414.m09247 DNA-binding protein, putative contains ... 36 0.020 At2g19260.1 68415.m02248 ELM2 domain-containing protein / PHD fi... 35 0.035 At1g05380.1 68414.m00546 PHD finger transcription factor, putative 35 0.035 At5g55800.1 68418.m06954 DC1 domain-containing protein contains ... 34 0.061 At5g36740.1 68418.m04402 PHD finger family protein 34 0.061 At5g36670.1 68418.m04388 PHD finger family protein 34 0.061 At3g14980.1 68416.m01894 PHD finger transcription factor, putati... 34 0.081 At4g14700.1 68417.m02259 replication control protein, putative s... 33 0.11 At2g02470.1 68415.m00186 PHD finger family protein contains Pfam... 33 0.11 At5g40590.1 68418.m04926 DC1 domain-containing protein predicted... 33 0.14 At2g17740.1 68415.m02055 DC1 domain-containing protein 33 0.14 At5g44770.1 68418.m05487 DC1 domain-containing protein contains ... 33 0.19 At2g44390.1 68415.m05521 DC1 domain-containing protein EST match... 33 0.19 At4g10370.1 68417.m01702 DC1 domain-containing protein contains ... 32 0.25 At2g44380.1 68415.m05520 DC1 domain-containing protein highly si... 32 0.25 At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding famil... 32 0.32 At5g09790.1 68418.m01133 PHD finger family protein / SET domain-... 31 0.43 At3g26550.1 68416.m03314 DC1 domain-containing protein contains ... 31 0.43 At2g28270.1 68415.m03431 DC1 domain-containing protein contains ... 31 0.43 At5g17960.1 68418.m02106 DC1 domain-containing protein contains ... 31 0.75 At2g44370.1 68415.m05519 DC1 domain-containing protein highly si... 31 0.75 At2g28460.1 68415.m03457 DC1 domain-containing protein contains ... 31 0.75 At5g22760.1 68418.m02658 PHD finger family protein contains Pfam... 30 0.99 At4g12620.1 68417.m01988 replication control protein, putative s... 30 0.99 At4g01920.1 68417.m00255 DC1 domain-containing protein similar t... 30 0.99 At3g19510.1 68416.m02472 homeobox protein (HAT 3.1) identical to... 30 0.99 At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein ... 30 0.99 At5g43520.1 68418.m05321 DC1 domain-containing protein contains ... 30 1.3 At1g57800.1 68414.m06558 zinc finger (C3HC4-type RING finger) fa... 30 1.3 At5g42280.1 68418.m05146 DC1 domain-containing protein contains ... 29 1.7 At5g35210.2 68418.m04175 peptidase M50 family protein / sterol-r... 29 1.7 At5g35210.1 68418.m04174 peptidase M50 family protein / sterol-r... 29 1.7 At5g12400.1 68418.m01458 PHD finger transcription factor, putati... 29 1.7 At2g36720.1 68415.m04505 PHD finger transcription factor, putative 29 1.7 At1g55380.1 68414.m06334 DC1 domain-containing protein contains ... 29 1.7 At1g48570.1 68414.m05431 zinc finger (Ran-binding) family protei... 29 1.7 At5g02330.1 68418.m00156 DC1 domain-containing protein contains ... 29 2.3 At3g07000.1 68416.m00831 DC1 domain-containing protein contains ... 29 2.3 At3g02890.1 68416.m00284 PHD finger protein-related contains low... 29 2.3 At1g53340.1 68414.m06046 DC1 domain-containing protein contains ... 29 2.3 At5g59550.1 68418.m07462 zinc finger (C3HC4-type RING finger) fa... 29 3.0 At5g55780.1 68418.m06952 DC1 domain-containing protein contains ... 29 3.0 At5g54040.1 68418.m06721 DC1 domain-containing protein contains ... 29 3.0 At3g13270.1 68416.m01670 hypothetical protein contains similarit... 29 3.0 At1g55390.1 68414.m06335 DC1 domain-containing protein similar t... 29 3.0 At1g35920.1 68414.m04461 hypothetical protein includes At5g34960... 29 3.0 At5g26190.1 68418.m03116 DC1 domain-containing protein contains ... 28 4.0 At2g37800.1 68415.m04641 DC1 domain-containing protein contains ... 28 4.0 At2g14450.1 68415.m01617 hypothetical protein includes At5g34960... 28 4.0 At1g14770.2 68414.m01766 expressed protein 28 4.0 At1g14770.1 68414.m01765 expressed protein 28 4.0 At5g45730.1 68418.m05622 DC1 domain-containing protein contains ... 28 5.3 At5g23910.1 68418.m02808 kinesin motor protein-related 28 5.3 At4g01910.1 68417.m00251 DC1 domain-containing protein contains ... 28 5.3 At3g42110.1 68416.m04323 hypothetical protein 28 5.3 At1g66040.1 68414.m07495 zinc finger (C3HC4-type RING finger) fa... 27 7.0 At1g06240.1 68414.m00660 expressed protein contains Pfam domain,... 27 7.0 At5g61100.1 68418.m07666 hypothetical protein 27 9.2 At5g54030.1 68418.m06720 DC1 domain-containing protein contains ... 27 9.2 At5g34960.1 68418.m04125 hypothetical protein includes At5g34960... 27 9.2 At3g59120.1 68416.m06591 DC1 domain-containing protein contains ... 27 9.2 At3g52100.1 68416.m05717 PHD finger family protein contains Pfam... 27 9.2 At3g13760.1 68416.m01736 DC1 domain-containing protein contains ... 27 9.2 At2g13900.1 68415.m01542 DC1 domain-containing protein contains ... 27 9.2 At2g02640.1 68415.m00203 DC1 domain-containing protein contain... 27 9.2 At2g02610.1 68415.m00200 DC1 domain-containing protein contain... 27 9.2 At1g66050.1 68414.m07497 zinc finger (C3HC4-type RING finger) fa... 27 9.2 At1g65180.1 68414.m07390 DC1 domain-containing protein contains ... 27 9.2 At1g55420.1 68414.m06339 DC1 domain-containing protein contains ... 27 9.2 >At1g77250.1 68414.m08997 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 522 Score = 43.2 bits (97), Expect = 1e-04 Identities = 15/48 (31%), Positives = 19/48 (39%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSCLAK 51 C CG+ DC C C D +H C G+ W C C +K Sbjct: 243 CKLCGEKAEARDCLACDHCEDMYHVSCAQPGGKGMPTHSWYCLDCTSK 290 Score = 30.7 bits (66), Expect = 0.75 Identities = 11/34 (32%), Positives = 15/34 (44%) Query: 19 CSKCSDNFHKGCVAIPSTGVAPRGWICPSCLAKV 52 C C D +H C+ P V W C +C A + Sbjct: 420 CDGCDDAYHIYCMRPPCESVPNGEWFCTACKAAI 453 >At5g46660.1 68418.m05749 CHP-rich zinc finger protein, putative contains similarity to CHP-rich zinc finger protein Length = 305 Score = 37.5 bits (83), Expect = 0.007 Identities = 14/31 (45%), Positives = 18/31 (58%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 CGAC K + + + C +C NFHK CV P Sbjct: 125 CGACEKIVLSTNYFACLQCQKNFHKECVQSP 155 >At3g01460.1 68416.m00070 PHD finger family protein / methyl-CpG binding domain-containing protein contains Pfam profiles PF00628: PHD-finger (2 copies), PF01429: Methyl-CpG binding domain Length = 2176 Score = 37.5 bits (83), Expect = 0.007 Identities = 16/47 (34%), Positives = 18/47 (38%) Query: 2 AKCGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSC 48 A CGACG+ S C C FH CV W+C C Sbjct: 84 ASCGACGRPESIELVVVCDACERGFHMSCVNDGVEAAPSADWMCSDC 130 Score = 34.7 bits (76), Expect = 0.046 Identities = 13/46 (28%), Positives = 17/46 (36%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSCL 49 C CG C C +H C+ P + W CPSC+ Sbjct: 1290 CKVCGVDKDDDSVLLCDTCDAEYHTYCLNPPLIRIPDGNWYCPSCV 1335 >At2g25170.1 68415.m03010 chromatin remodeling factor CHD3 (PICKLE) identical to chromatin remodeling factor CHD3 [Arabidopsis thaliana] GI:6478518 Length = 1384 Score = 36.7 bits (81), Expect = 0.011 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSCLA 50 C ACG+ + + C+ C+ FH C+ P + W CP C++ Sbjct: 52 CQACGE---STNLVSCNTCTYAFHAKCLVPPLKDASVENWRCPECVS 95 >At5g63900.1 68418.m08023 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 557 Score = 36.3 bits (80), Expect = 0.015 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Query: 4 CGACGKFLSTADCA--RCSKCSDNFHKGCVAIPSTGVAPRGWICPS 47 C CG S A+ C +C FH C+ S V+ RGW C S Sbjct: 301 CDICGSMESPANSKLMACEQCQRRFHLTCLKEDSCIVSSRGWFCSS 346 >At5g55770.1 68418.m06951 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 695 Score = 36.3 bits (80), Expect = 0.015 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 1 MAKCGAC-GKFLSTADCARCSKCSDNFHKGCVAIP 34 +++CGAC GK L T+ C +C FH+ CV P Sbjct: 153 ISQCGACKGKMLDTSKDYACLQCQRKFHRECVESP 187 >At5g24330.1 68418.m02867 PHD finger family protein / SET domain-containing protein contains Pfam domain, PF00628: PHD-finger and PF00856: SET domain Length = 349 Score = 36.3 bits (80), Expect = 0.015 Identities = 15/45 (33%), Positives = 16/45 (35%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSC 48 C C A C KC FH C+ V W CPSC Sbjct: 35 CEECSSGKQPAKLLLCDKCDKGFHLFCLRPILVSVPKGSWFCPSC 79 >At1g79350.1 68414.m09247 DNA-binding protein, putative contains Pfam PF00628: PHD-finger domain; contains TIGRFAMS TIGR01053: zinc finger domain, LSD1 subclass; contains Pfam PF00271: Helicase conserved C-terminal domain; similar to WSSV086 (GI:19481678)[shrimp white spot syndrome virus]; similar to nuclear protein Np95 (GI:17939938) [Mus musculus] Length = 1299 Score = 35.9 bits (79), Expect = 0.020 Identities = 16/48 (33%), Positives = 18/48 (37%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSCLAK 51 C C CS+C FH CV P + WIC SC K Sbjct: 704 CQICSGEDERKKLLHCSECDKLFHPDCVVPPVIDLPSEAWICFSCKEK 751 >At2g19260.1 68415.m02248 ELM2 domain-containing protein / PHD finger family protein contains Pfam profiles: PF01448 ELM2 domain, PF00628 PHD-finger Length = 631 Score = 35.1 bits (77), Expect = 0.035 Identities = 15/48 (31%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Query: 3 KCGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAP-RGWICPSCL 49 +C C K + C +C + +H C + VA W+CPSCL Sbjct: 411 QCKHCDKPGTVEKMLICDECEEAYHTRCCGVQMKDVAEIDEWLCPSCL 458 >At1g05380.1 68414.m00546 PHD finger transcription factor, putative Length = 600 Score = 35.1 bits (77), Expect = 0.035 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 7/49 (14%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRG-WICPSCLAK 51 CG CG D C C +H+ C+ + V P G W CP+C K Sbjct: 90 CGICG---DGGDLICCDGCPSTYHQNCLGMQ---VLPSGDWHCPNCTCK 132 >At5g55800.1 68418.m06954 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 578 Score = 34.3 bits (75), Expect = 0.061 Identities = 15/38 (39%), Positives = 19/38 (50%) Query: 3 KCGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAP 40 +CGACG+ +A C C FHK CV P + P Sbjct: 90 RCGACGRPTLSATYYACLICEKMFHKECVESPFEIIHP 127 >At5g36740.1 68418.m04402 PHD finger family protein Length = 1179 Score = 34.3 bits (75), Expect = 0.061 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 7/57 (12%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRG-WICPSCLAKVPRGDNAA 59 CG CG D C C FH+ C+ I P G W C +C K D AA Sbjct: 653 CGICG---DGGDLICCDGCPSTFHQSCLDIKK---FPSGAWYCYNCSCKFCEKDEAA 703 >At5g36670.1 68418.m04388 PHD finger family protein Length = 1193 Score = 34.3 bits (75), Expect = 0.061 Identities = 20/57 (35%), Positives = 23/57 (40%), Gaps = 7/57 (12%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRG-WICPSCLAKVPRGDNAA 59 CG CG D C C FH+ C+ I P G W C +C K D AA Sbjct: 653 CGICG---DGGDLICCDGCPSTFHQSCLDIKK---FPSGAWYCYNCSCKFCEKDEAA 703 >At3g14980.1 68416.m01894 PHD finger transcription factor, putative contains Pfam profile: PF00628 PHD-finger Length = 1189 Score = 33.9 bits (74), Expect = 0.081 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 7/46 (15%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRG-WICPSC 48 CG CG + C C FH+ C+ S V P G W C SC Sbjct: 729 CGVCG---DGGELICCDNCPSTFHQACL---SMQVLPEGSWYCSSC 768 >At4g14700.1 68417.m02259 replication control protein, putative similar to origin recognition complex subunit 1 (Replication control protein 1) [Homo sapiens] SWISS-PROT:Q13415 Length = 809 Score = 33.5 bits (73), Expect = 0.11 Identities = 15/48 (31%), Positives = 17/48 (35%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSCLAK 51 C C K + C C FH C+ P V WIC C K Sbjct: 166 CQICFKSHTNTIMIECDDCLGGFHLNCLKPPLKEVPEGDWICQFCEVK 213 >At2g02470.1 68415.m00186 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 256 Score = 33.5 bits (73), Expect = 0.11 Identities = 20/55 (36%), Positives = 25/55 (45%), Gaps = 2/55 (3%) Query: 2 AKCGACGKFLSTAD-CARCSKCSDNFHKGCVAI-PSTGVAPRGWICPSCLAKVPR 54 A CGACG T + C C FH CV I P+ + + CP+C K R Sbjct: 201 AVCGACGDNYGTDEFWICCDACEKWFHGKCVKITPAKAEHIKHYKCPTCSNKRAR 255 >At5g40590.1 68418.m04926 DC1 domain-containing protein predicted protein, Arabidopsis thaliana Length = 234 Score = 33.1 bits (72), Expect = 0.14 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPST 36 C ACG++ S+ CS C + H GCV++P T Sbjct: 86 CNACGEYGSSFTY-NCSICQYDVHVGCVSMPET 117 >At2g17740.1 68415.m02055 DC1 domain-containing protein Length = 248 Score = 33.1 bits (72), Expect = 0.14 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPST 36 C ACG++ + CS C + H GCV++P T Sbjct: 88 CDACGEY-GSGFTYNCSICQYDVHVGCVSVPET 119 >At5g44770.1 68418.m05487 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 541 Score = 32.7 bits (71), Expect = 0.19 Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 CG C ++ C +C +C HKGC ++P Sbjct: 282 CGGCILPINDDPCYKCVECDFCLHKGCASLP 312 >At2g44390.1 68415.m05521 DC1 domain-containing protein EST matches across the predicted intron; maybe a pseudo gene; highly similar to GP|2435515|AF024504; contains Pfam profile PF03107: DC1 domain Length = 209 Score = 32.7 bits (71), Expect = 0.19 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPST 36 C ACG++ + CS+C + H GC IP T Sbjct: 55 CDACGEY-GSGFTYNCSECQYDLHVGCAFIPET 86 >At4g10370.1 68417.m01702 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 687 Score = 32.3 bits (70), Expect = 0.25 Identities = 12/32 (37%), Positives = 16/32 (50%) Query: 3 KCGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 +CG C + +A C +C FHK CV P Sbjct: 131 QCGGCRDSMLSASYYACLQCEKKFHKECVESP 162 >At2g44380.1 68415.m05520 DC1 domain-containing protein highly similar to GP|2435515|AF024504; contains Pfam profile PF03107: DC1 domain Length = 247 Score = 32.3 bits (70), Expect = 0.25 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPST 36 C ACG++ + CS+C + H GC IP T Sbjct: 92 CDACGEY-GSGFTYNCSECQYDVHVGCAFIPET 123 >At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding family protein / CHD family protein similar to chromatin remodeling factor CHD3 (PICKLE) [Arabidopsis thaliana] GI:6478518; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00628: PHD-finger, PF00385: 'chromo' (CHRromatin Organization MOdifier) Length = 2228 Score = 31.9 bits (69), Expect = 0.32 Identities = 11/34 (32%), Positives = 14/34 (41%) Query: 15 DCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSC 48 D C C +H C+ P + WICP C Sbjct: 72 DLLCCDSCPRTYHTACLNPPLKRIPNGKWICPKC 105 >At5g09790.1 68418.m01133 PHD finger family protein / SET domain-containing protein contains Pfam domain, PF00628: PHD-finger and PF00856: SET domain Length = 352 Score = 31.5 bits (68), Expect = 0.43 Identities = 16/51 (31%), Positives = 20/51 (39%), Gaps = 2/51 (3%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRG-WICPSCLAKVP 53 C CG + C KC FH C+ P P G W+C C + P Sbjct: 67 CEKCGSGEGDDELLLCDKCDRGFHMKCLR-PIVVRVPIGTWLCVDCSDQRP 116 >At3g26550.1 68416.m03314 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 681 Score = 31.5 bits (68), Expect = 0.43 Identities = 11/32 (34%), Positives = 17/32 (53%) Query: 3 KCGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 +CG C + ++ C +C + FHK CV P Sbjct: 124 ECGGCEESKTSRSYYACLECGNKFHKQCVESP 155 >At2g28270.1 68415.m03431 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 248 Score = 31.5 bits (68), Expect = 0.43 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 C ACG++ +A CS+C + H GC +P Sbjct: 92 CDACGEY-GSAFTYHCSECKYHVHVGCAFVP 121 >At5g17960.1 68418.m02106 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 599 Score = 30.7 bits (66), Expect = 0.75 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Query: 2 AKCGACGKFLSTADCA---RCSKCSDNFHKGCVAIP 34 + C CGK +ST+ C+ C +FH+ CV IP Sbjct: 38 SNCFTCGKQVSTSSRGFHYHCTICDVDFHEECVNIP 73 >At2g44370.1 68415.m05519 DC1 domain-containing protein highly similar to GP|2435515|AF024504 Length = 250 Score = 30.7 bits (66), Expect = 0.75 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPST 36 C ACG++ + CS C + H GCV++P + Sbjct: 88 CDACGEY-GSGFTYNCSICQYDVHVGCVSMPES 119 >At2g28460.1 68415.m03457 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 704 Score = 30.7 bits (66), Expect = 0.75 Identities = 11/31 (35%), Positives = 15/31 (48%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 C ACG S+ C C HK C+++P Sbjct: 284 CNACGLSHSSCPLYMCPPCDFVIHKSCISLP 314 >At5g22760.1 68418.m02658 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 1566 Score = 30.3 bits (65), Expect = 0.99 Identities = 14/49 (28%), Positives = 19/49 (38%), Gaps = 3/49 (6%) Query: 3 KCGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSCLAK 51 +C CG T C C C +H C+ + + W CP C K Sbjct: 415 ECRLCGMD-GTLLC--CDGCPLAYHSRCIGVVKMYIPDGPWYCPECTIK 460 >At4g12620.1 68417.m01988 replication control protein, putative similar to origin recognition complex subunit 1 (Replication control protein 1)[Homo sapiens] SWISS-PROT:Q13415 Length = 813 Score = 30.3 bits (65), Expect = 0.99 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 1/48 (2%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSCLAK 51 C C K T C C FH C+ P V WIC C K Sbjct: 169 CQICFKS-DTNIMIECDDCLGGFHLKCLKPPLKEVPEGDWICQFCEVK 215 >At4g01920.1 68417.m00255 DC1 domain-containing protein similar to A. thaliana CHP-rich proteins Length = 658 Score = 30.3 bits (65), Expect = 0.99 Identities = 12/32 (37%), Positives = 15/32 (46%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPS 35 CG CG+F + +D C C K C PS Sbjct: 28 CGCCGRFEAISDGYYCKTCDFFVRKNCADEPS 59 >At3g19510.1 68416.m02472 homeobox protein (HAT 3.1) identical to homeotic protein HAT 3.1 (GI:11994474) [Arabidopsis thaliana] Length = 723 Score = 30.3 bits (65), Expect = 0.99 Identities = 20/55 (36%), Positives = 24/55 (43%), Gaps = 7/55 (12%) Query: 4 CGACG-KFLSTA-DCARCSK-CSDNFHKGCVAIP--STGVAP--RGWICPSCLAK 51 C CG K LS D C C FH+ C+ P + P GW+CP C K Sbjct: 268 CAKCGSKDLSVDNDIILCDGFCDRGFHQYCLEPPLRKEDIPPDDEGWLCPGCDCK 322 >At1g20110.1 68414.m02516 zinc finger (FYVE type) family protein contains Pfam profile: PF01363 FYVE zinc finger Length = 601 Score = 30.3 bits (65), Expect = 0.99 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 5/57 (8%) Query: 1 MAKCGACGK----FLSTADCARCSKC-SDNFHKGCVAIPSTGVAPRGWICPSCLAKV 52 ++KC +CG F+ C C D +G +A+ + AP+ +C C+A+V Sbjct: 458 VSKCTSCGSDFGAFIRRHHCRNCGDVFCDKCTQGRIALTAEDNAPQVRVCDRCMAEV 514 >At5g43520.1 68418.m05321 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 250 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPST 36 C AC ++ + CS C+ + H GC IP T Sbjct: 97 CDACDQY-GSGFSYHCSNCNYSLHVGCAFIPET 128 >At1g57800.1 68414.m06558 zinc finger (C3HC4-type RING finger) family protein contains zinc finger, C3HC4 type (RING finger), signature, PROSITE:PS00518 Length = 660 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/46 (28%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCV-AIPSTGVAPRGWICPSC 48 C C + C C +H C+ + P T A W+CP C Sbjct: 15 CMRCKSMPPPEESLTCGTCVTPWHVSCLLSPPETLSATLQWLCPDC 60 >At5g42280.1 68418.m05146 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 694 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 2/33 (6%) Query: 4 CGACGKFLSTAD--CARCSKCSDNFHKGCVAIP 34 C ACG LS D C CS H+ C+ +P Sbjct: 267 CDACGLSLSETDDLVYACLPCSHMVHRSCIYLP 299 >At5g35210.2 68418.m04175 peptidase M50 family protein / sterol-regulatory element binding protein (SREBP) site 2 protease family protein contains PFam PF02163: sterol-regulatory element binding protein (SREBP) site 2 protease Length = 1409 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/46 (28%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Query: 3 KCGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSC 48 +C CG T C C C +H C+ + + W CP C Sbjct: 413 ECRICGMD-GTLLC--CDGCPLAYHSRCIGVVKMYIPDGPWFCPEC 455 >At5g35210.1 68418.m04174 peptidase M50 family protein / sterol-regulatory element binding protein (SREBP) site 2 protease family protein contains PFam PF02163: sterol-regulatory element binding protein (SREBP) site 2 protease Length = 1576 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/46 (28%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Query: 3 KCGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSC 48 +C CG T C C C +H C+ + + W CP C Sbjct: 413 ECRICGMD-GTLLC--CDGCPLAYHSRCIGVVKMYIPDGPWFCPEC 455 >At5g12400.1 68418.m01458 PHD finger transcription factor, putative similarity to predicted proteins, Arabidopsis thaliana Length = 1595 Score = 29.5 bits (63), Expect = 1.7 Identities = 10/30 (33%), Positives = 13/30 (43%) Query: 19 CSKCSDNFHKGCVAIPSTGVAPRGWICPSC 48 C C +H CV + S + W CP C Sbjct: 623 CDGCPAAYHSKCVGLASHLLPEGDWYCPEC 652 >At2g36720.1 68415.m04505 PHD finger transcription factor, putative Length = 1007 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Query: 19 CSKCSDNFHKGCVAIPSTGVAPRG-WICPSC 48 C C FH CV++PS PRG W C C Sbjct: 630 CDSCPRAFHIECVSLPS---IPRGNWHCKYC 657 >At1g55380.1 68414.m06334 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 661 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Query: 4 CGACGKFLSTAD--CARCSKCSDNFHKGCVAIP 34 CGACG LS A+ C C+ H+ C+ +P Sbjct: 221 CGACGLSLSDAEDLVYACLPCNLLVHRSCIYLP 253 >At1g48570.1 68414.m05431 zinc finger (Ran-binding) family protein contains Pfam domain, PF00641: Zn-finger in Ran binding protein and others Length = 455 Score = 29.5 bits (63), Expect = 1.7 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 8/45 (17%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSC 48 C CG +++ A +C +C + HK T P W CPSC Sbjct: 382 CTGCG-YMNFASNKQCRECREQRHK-------TLAEPGDWECPSC 418 >At5g02330.1 68418.m00156 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 656 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 CGAC + D C C FHK CV P Sbjct: 143 CGACERSKIGTDYYICLTCDLMFHKECVESP 173 >At3g07000.1 68416.m00831 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 574 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 CGACGK+L C+ C N C +P Sbjct: 397 CGACGKYLHYV--LSCTVCEFNLGMDCATLP 425 >At3g02890.1 68416.m00284 PHD finger protein-related contains low similarity to PHD-finger domain proteins Length = 963 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSC 48 CG G+ A C+RCS ++ H C+ + V W+C C Sbjct: 208 CGDAGREDLLAICSRCSDGAE--HTYCMRVMLKKVPKGYWLCEEC 250 >At1g53340.1 68414.m06046 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 667 Score = 29.1 bits (62), Expect = 2.3 Identities = 12/31 (38%), Positives = 12/31 (38%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 C AC C C D FHK CV P Sbjct: 127 CRACTTIEQGTSYYVCVTCGDQFHKECVGAP 157 >At5g59550.1 68418.m07462 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 407 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/56 (28%), Positives = 22/56 (39%), Gaps = 4/56 (7%) Query: 2 AKCGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSCLAKVPRGDN 57 A C C + T AR C FH C+ +P + CP C ++P N Sbjct: 197 ANCAVCTEIFETETEAREMPCKHLFHDDCI-VPWLSIRNS---CPVCRFELPSEPN 248 >At5g55780.1 68418.m06952 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 685 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/31 (35%), Positives = 14/31 (45%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 C AC + + C +C FHK CV P Sbjct: 136 CRACNGNIFSTSYFTCLQCQGKFHKECVESP 166 >At5g54040.1 68418.m06721 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 596 Score = 28.7 bits (61), Expect = 3.0 Identities = 10/32 (31%), Positives = 15/32 (46%) Query: 3 KCGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 +C C ++ C RC +C HK C +P Sbjct: 314 RCRCCVLAINGDPCYRCVECDFILHKACANLP 345 >At3g13270.1 68416.m01670 hypothetical protein contains similarity to replication protein A1 Length = 570 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 16 CARCSKCSDNFHKGCVAIPSTGVAPRGWICPSC 48 C C+K + H G + + G PR W C SC Sbjct: 295 CRACNKKVTHIHSGVHGVNNKGKKPRFW-CDSC 326 >At1g55390.1 68414.m06335 DC1 domain-containing protein similar to hypothetical protein GI:4204272 from [Arabidopsis thaliana] contains weak PHD zinc finger motifs contains weak PHD zinc finger motifs DC1 domain, a divergent protein kinase C domain of unknown function. Length = 684 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Query: 4 CGACGKFLS-TADCA-RCSKCSDNFHKGCVAIP 34 C ACG LS T D C CS H+ C+ +P Sbjct: 263 CDACGLSLSDTIDLIYACLPCSHMIHRSCIYLP 295 >At1g35920.1 68414.m04461 hypothetical protein includes At5g34960, At2g14450, At1g35920 Length = 567 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 16 CARCSKCSDNFHKGCVAIPSTGVAPRGWICPSCLAKV 52 C C+K ++ H G + + G PR W C +C + V Sbjct: 293 CKTCNKKVNHIHAGVNGVNNKGKKPRFW-CDTCTSVV 328 >At5g26190.1 68418.m03116 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 556 Score = 28.3 bits (60), Expect = 4.0 Identities = 10/32 (31%), Positives = 17/32 (53%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPS 35 C ACG +++ C +C H+ C+ +PS Sbjct: 142 CDACGSVDNSSYPCTCLQCCFIIHRDCIDLPS 173 >At2g37800.1 68415.m04641 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 396 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/33 (36%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPST 36 C C K RC++C N H C PST Sbjct: 165 CDGC-KTYGFGKTYRCTRCDYNLHDHCATCPST 196 >At2g14450.1 68415.m01617 hypothetical protein includes At5g34960, At2g14450, At1g35920 Length = 544 Score = 28.3 bits (60), Expect = 4.0 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 15 DCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSC 48 +C C+K ++ H G + + G PR W C +C Sbjct: 282 NCKTCNKKVNHIHAGVNGVNNKGKKPRFW-CETC 314 >At1g14770.2 68414.m01766 expressed protein Length = 429 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSC 48 C C K + C+R S+C+ HK C+ P ++CP C Sbjct: 348 CWKCEKEGTLLICSR-SECAAKVHKECLNCPVNVDEYGNFLCPLC 391 >At1g14770.1 68414.m01765 expressed protein Length = 429 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/45 (31%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSC 48 C C K + C+R S+C+ HK C+ P ++CP C Sbjct: 348 CWKCEKEGTLLICSR-SECAAKVHKECLNCPVNVDEYGNFLCPLC 391 >At5g45730.1 68418.m05622 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 519 Score = 27.9 bits (59), Expect = 5.3 Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 C ACG + + C +C HKGC+ +P Sbjct: 145 CNACG-LVGDRNPYVCLECDFMLHKGCINLP 174 >At5g23910.1 68418.m02808 kinesin motor protein-related Length = 665 Score = 27.9 bits (59), Expect = 5.3 Identities = 26/94 (27%), Positives = 41/94 (43%), Gaps = 3/94 (3%) Query: 115 RSVRDALLKGARVRRYLST-TDLDVPGTVRTVYLNERLSAYN-RQLFGTARQKGKDKGWK 172 R ++D L KG+ + ++ T L T R +N SA R+LFG A K K Sbjct: 265 RMLKDCL-KGSNITLLITCLTVLRGNVTERKTKINTATSAIKARKLFGEANDSVKCKNSS 323 Query: 173 YVWTKDGRIYIRRGDGTPALRIRVQADLKKHFGP 206 ++ +++G T + + VQA K P Sbjct: 324 KKVEGKAKMVLKKGISTSKVVLSVQASSPKEVNP 357 >At4g01910.1 68417.m00251 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 651 Score = 27.9 bits (59), Expect = 5.3 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Query: 4 CGA-CGKFLSTADCARCSKCSDNFHKGCVAIPS 35 C A CGK +C +C FH CV PS Sbjct: 136 CDAKCGKISGNEFAYKCQECDLTFHVDCVWHPS 168 >At3g42110.1 68416.m04323 hypothetical protein Length = 448 Score = 27.9 bits (59), Expect = 5.3 Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 16 CARCSKCSDNFHKGCVAIPSTGVAPRGWICPSC 48 C C+K ++ H G + + G PR W C +C Sbjct: 230 CKTCNKKVNHIHAGVHGVNNKGKKPRFW-CDTC 261 >At1g66040.1 68414.m07495 zinc finger (C3HC4-type RING finger) family protein contains zinc finger, C3HC4 type (RING finger), signature, PROSITE:PS00518 Length = 622 Score = 27.5 bits (58), Expect = 7.0 Identities = 11/45 (24%), Positives = 16/45 (35%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSC 48 C C + + C C +H C+ S + W CP C Sbjct: 15 CMRCQVTPPSEETLTCGTCVTPWHVSCLLPESLASSTGDWECPDC 59 >At1g06240.1 68414.m00660 expressed protein contains Pfam domain, PF04305: Protein of unknown function (DUF455) Length = 383 Score = 27.5 bits (58), Expect = 7.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Query: 40 PRGWICPSCLAKVPRGDN 57 PR W PSC +V +GDN Sbjct: 333 PRDWYDPSCGTEVDKGDN 350 >At5g61100.1 68418.m07666 hypothetical protein Length = 227 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Query: 4 CGACGKFLSTADCARCSKCSDNF-HKGCVAIPSTGVAPRGWICPSC 48 C CG + C C D H C + V PR WIC C Sbjct: 34 CEVCGSDANELLMMTCFMCRDTREHTYCARVMFQRV-PRLWICEEC 78 >At5g54030.1 68418.m06720 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 419 Score = 27.1 bits (57), Expect = 9.2 Identities = 9/32 (28%), Positives = 16/32 (50%) Query: 3 KCGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 +C C ++ C RC +C+ H+ C +P Sbjct: 299 RCRCCILAINGDPCYRCVECNFILHEACANLP 330 >At5g34960.1 68418.m04125 hypothetical protein includes At5g34960, At2g14450, At1g35920 Length = 1033 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Query: 16 CARCSKCSDNFHKGCVAIPSTGVAPRGWICPSCLAKV 52 C C+K ++ H G + + G P+ W C +C + V Sbjct: 282 CKTCNKKVNHIHAGVNGVNNKGKKPKFW-CDTCKSVV 317 >At3g59120.1 68416.m06591 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 602 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/31 (35%), Positives = 13/31 (41%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 C ACG C +C HK CV +P Sbjct: 187 CDACGLINLLDPSYACHQCDYMVHKSCVDLP 217 >At3g52100.1 68416.m05717 PHD finger family protein contains Pfam profile PF00628: PHD-finger Length = 696 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/43 (25%), Positives = 16/43 (37%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICP 46 C CG C +C D +H C V+ ++CP Sbjct: 216 CEGCGTLGDPKKFMFCKRCDDAYHCDCQHPRHKNVSSGPYLCP 258 >At3g13760.1 68416.m01736 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 652 Score = 27.1 bits (57), Expect = 9.2 Identities = 9/34 (26%), Positives = 16/34 (47%) Query: 1 MAKCGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 + C ACG + C +C+ H+ C+ +P Sbjct: 223 LVPCDACGLVNALEPSYACFQCNYMIHQNCIDLP 256 >At2g13900.1 68415.m01542 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 661 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/31 (38%), Positives = 14/31 (45%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 CGAC + + C C FHK CV P Sbjct: 145 CGACERSKIGTNYYVCLTCDLMFHKECVESP 175 >At2g02640.1 68415.m00203 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 627 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/32 (34%), Positives = 14/32 (43%) Query: 3 KCGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 +C +C D C+ C FHK CV P Sbjct: 118 ECYSCSIQTIGTDYYFCATCDKRFHKECVECP 149 >At2g02610.1 68415.m00200 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 627 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/32 (34%), Positives = 14/32 (43%) Query: 3 KCGACGKFLSTADCARCSKCSDNFHKGCVAIP 34 +C +C D C+ C FHK CV P Sbjct: 118 ECYSCSIQTIGTDYYFCATCDKRFHKECVECP 149 >At1g66050.1 68414.m07497 zinc finger (C3HC4-type RING finger) family protein contains zinc finger, C3HC4 type (RING finger), signature, PROSITE:PS00518 Length = 623 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/45 (24%), Positives = 16/45 (35%) Query: 4 CGACGKFLSTADCARCSKCSDNFHKGCVAIPSTGVAPRGWICPSC 48 C C + + C C +H C+ S + W CP C Sbjct: 15 CMRCQVNPPSEETLTCGTCVTPWHVSCLLPESLASSTGDWECPDC 59 >At1g65180.1 68414.m07390 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 653 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Query: 3 KCGACG-KFLSTADCARCSKCSDNFHKGCVAIP 34 KC CG +F + +D C KC FHK C P Sbjct: 25 KC--CGLQFKTISDGYNCRKCRYFFHKSCSNCP 55 >At1g55420.1 68414.m06339 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 725 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Query: 4 CGACGKFLS-TADCA-RCSKCSDNFHKGCVAIP 34 C ACG L+ T D C CS H+ C+ +P Sbjct: 260 CDACGLSLNDTEDLVYSCLPCSRMVHRSCIYLP 292 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.324 0.139 0.447 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,629,019 Number of Sequences: 28952 Number of extensions: 169597 Number of successful extensions: 741 Number of sequences better than 10.0: 76 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 38 Number of HSP's that attempted gapping in prelim test: 673 Number of HSP's gapped (non-prelim): 114 length of query: 209 length of database: 12,070,560 effective HSP length: 78 effective length of query: 131 effective length of database: 9,812,304 effective search space: 1285411824 effective search space used: 1285411824 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.5 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -