BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001491-TA|BGIBMGA001491-PA|IPR002557|Chitin binding Peritrophin-A (222 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0242 + 42234217-42234320,42234708-42235029,42235377-422357... 28 5.3 01_05_0626 + 23797278-23797618,23797629-23798097 28 5.3 >01_07_0242 + 42234217-42234320,42234708-42235029,42235377-42235778, 42235921-42236265,42236785-42236854,42237098-42237173, 42237309-42237459 Length = 489 Score = 28.3 bits (60), Expect = 5.3 Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 126 ENVNTGPCNCDPKQALSLCAQEGSNGKLVAH 156 ++ N P CD ++A SL +E S GK ++H Sbjct: 315 QSQNVDPVYCDDRRAASLKMEEPSQGKDLSH 345 >01_05_0626 + 23797278-23797618,23797629-23798097 Length = 269 Score = 28.3 bits (60), Expect = 5.3 Identities = 21/67 (31%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Query: 146 QEGSNGKLVAHNVCSHYHMCVSGKTLSLACPSNLFYDPQKERCDFPANVSCEARVAPVFL 205 +E S L H +CS SG + +F + C P V EAR +PV Sbjct: 95 EESSPISLDLHLICSEEDPIWSGCHDESRVQATVFSNGTNGWCHLPW-VDIEARASPVAP 153 Query: 206 PPLNKHW 212 NKHW Sbjct: 154 HDGNKHW 160 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.321 0.136 0.481 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,267,246 Number of Sequences: 37544 Number of extensions: 288609 Number of successful extensions: 441 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 440 Number of HSP's gapped (non-prelim): 2 length of query: 222 length of database: 14,793,348 effective HSP length: 79 effective length of query: 143 effective length of database: 11,827,372 effective search space: 1691314196 effective search space used: 1691314196 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -