BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA001491-TA|BGIBMGA001491-PA|IPR002557|Chitin binding
Peritrophin-A
         (222 letters)
Database: spombe 
           5004 sequences; 2,362,478 total letters
Searching..................................................done
                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value
SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schi...    30   0.24 
>SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase
           Lkh1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 690
 Score = 30.3 bits (65), Expect = 0.24
 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 3/67 (4%)
Query: 149 SNGKL-VAHNVCSHYHMCVSGKTLSLACPSNLFYDPQKERCDF--PANVSCEARVAPVFL 205
           +NG + + H+V SH    V   T   AC +N    P         P  VSC+  + P  +
Sbjct: 99  ANGVVPLPHDVASHPSYMVQSPTSYHACSNNQSPFPHSHHPPLHNPLPVSCQPVLRPPPV 158
Query: 206 PPLNKHW 212
           P +  HW
Sbjct: 159 PQVPSHW 165
  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.321    0.136    0.481 
Gapped
Lambda     K      H
   0.279   0.0580    0.190 
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,094,886
Number of Sequences: 5004
Number of extensions: 42280
Number of successful extensions: 67
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 67
Number of HSP's gapped (non-prelim): 1
length of query: 222
length of database: 2,362,478
effective HSP length: 70
effective length of query: 152
effective length of database: 2,012,198
effective search space: 305854096
effective search space used: 305854096
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 52 (25.0 bits)
- SilkBase 1999-2023 -