BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001491-TA|BGIBMGA001491-PA|IPR002557|Chitin binding Peritrophin-A (222 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schi... 30 0.24 >SPAC1D4.11c |lkh1|kic1|dual specificity protein kinase Lkh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 690 Score = 30.3 bits (65), Expect = 0.24 Identities = 20/67 (29%), Positives = 29/67 (43%), Gaps = 3/67 (4%) Query: 149 SNGKL-VAHNVCSHYHMCVSGKTLSLACPSNLFYDPQKERCDF--PANVSCEARVAPVFL 205 +NG + + H+V SH V T AC +N P P VSC+ + P + Sbjct: 99 ANGVVPLPHDVASHPSYMVQSPTSYHACSNNQSPFPHSHHPPLHNPLPVSCQPVLRPPPV 158 Query: 206 PPLNKHW 212 P + HW Sbjct: 159 PQVPSHW 165 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.321 0.136 0.481 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,094,886 Number of Sequences: 5004 Number of extensions: 42280 Number of successful extensions: 67 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 67 Number of HSP's gapped (non-prelim): 1 length of query: 222 length of database: 2,362,478 effective HSP length: 70 effective length of query: 152 effective length of database: 2,012,198 effective search space: 305854096 effective search space used: 305854096 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -