BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001489-TA|BGIBMGA001489-PA|undefined (490 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 25 1.6 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 24.6 bits (51), Expect = 1.6 Identities = 12/37 (32%), Positives = 20/37 (54%) Query: 201 PIPTTYVPRLNLTLGQTLSTLTEVTEPVRPEMLNVCN 237 P PT VP+ + + L+ TEV+ P + L++ N Sbjct: 237 PKPTPLVPQQGFNMERLLAPSTEVSAPFFRQPLDLYN 273 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.314 0.129 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,759 Number of Sequences: 317 Number of extensions: 4909 Number of successful extensions: 3 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 1 length of query: 490 length of database: 114,650 effective HSP length: 59 effective length of query: 431 effective length of database: 95,947 effective search space: 41353157 effective search space used: 41353157 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -