GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001489-TA|BGIBMGA001489-PA|undefined
         (490 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ414248-1|ABD63010.2|  311|Tribolium castaneum sloppy-paired pr...    25   1.6  

>DQ414248-1|ABD63010.2|  311|Tribolium castaneum sloppy-paired
           protein.
          Length = 311

 Score = 24.6 bits (51), Expect = 1.6
 Identities = 12/37 (32%), Positives = 20/37 (54%)

Query: 201 PIPTTYVPRLNLTLGQTLSTLTEVTEPVRPEMLNVCN 237
           P PT  VP+    + + L+  TEV+ P   + L++ N
Sbjct: 237 PKPTPLVPQQGFNMERLLAPSTEVSAPFFRQPLDLYN 273


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.314    0.129    0.385 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 113,759
Number of Sequences: 317
Number of extensions: 4909
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2
Number of HSP's gapped (non-prelim): 1
length of query: 490
length of database: 114,650
effective HSP length: 59
effective length of query: 431
effective length of database: 95,947
effective search space: 41353157
effective search space used: 41353157
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (22.0 bits)
S2: 45 (22.2 bits)