BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001488-TA|BGIBMGA001488-PA|IPR001766|Fork head transcription factor (315 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 40 9e-05 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 26 1.6 AY062202-1|AAL58563.1| 151|Anopheles gambiae cytochrome P450 CY... 25 2.8 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 3.7 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 25 3.7 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 8.5 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 39.9 bits (89), Expect = 9e-05 Identities = 17/38 (44%), Positives = 25/38 (65%) Query: 80 SYIGLIAMAILSSPERKLVLSDIYQHILDNYPYFRTRG 117 SY LI AI S+ + +L LS IY+ ++ N PYF+ +G Sbjct: 120 SYADLITQAISSASDSRLTLSQIYEWMVQNVPYFKDKG 157 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 25.8 bits (54), Expect = 1.6 Identities = 26/82 (31%), Positives = 37/82 (45%), Gaps = 14/82 (17%) Query: 9 SWPLGKDAPTVTAAAIDHYRLQLYNYAVAERLR--LYP--PTVA-----PCYGPYGPRLA 59 S+P G D+ AA Y Q YA+A ++ YP PT A P Y Y P Sbjct: 147 SYPWGNDS-----AADYAYHAQYPPYALATDIKPMYYPSYPTEANFQPHPYYPKYEPDAY 201 Query: 60 LSMSLLQQRALQPEEPKPQHSY 81 ++ S + R + ++P Q SY Sbjct: 202 ITASTERSRGVTGDQPSLQSSY 223 >AY062202-1|AAL58563.1| 151|Anopheles gambiae cytochrome P450 CYP4H14 protein. Length = 151 Score = 25.0 bits (52), Expect = 2.8 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 6/37 (16%) Query: 12 LGKDAPTVTAAAIDHYRLQLYNY---AVAERLRLYPP 45 LGKD T A + + LQ + Y V E LR+YPP Sbjct: 42 LGKDHKT---AELTYQNLQEFKYLDLVVKEGLRMYPP 75 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.6 bits (51), Expect = 3.7 Identities = 12/34 (35%), Positives = 19/34 (55%) Query: 244 DEEPEEDIDVVASDQEERGVDEETRGPLTTATQY 277 D EPE+D + +E + + + T GPL+ QY Sbjct: 291 DGEPEKDEENDDLRRELKSIPDPTVGPLSYLKQY 324 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 24.6 bits (51), Expect = 3.7 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 14/74 (18%) Query: 39 RLRLYPPTVAPCYGPYGPRLALSMS--------LLQQRALQPEEPKPQHSY----IGLIA 86 ++R+YPPT PYG RL ++ L + ++ ++ Q Y +G Sbjct: 314 KMRVYPPT--KIVTPYGGRLIWTLPGRTKMIAHLKDKNKIRHKKRWSQVMYMYYLLGYRI 371 Query: 87 MAILSSPERKLVLS 100 M + +SPERK+V++ Sbjct: 372 MQLNTSPERKMVIA 385 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.4 bits (48), Expect = 8.5 Identities = 9/13 (69%), Positives = 11/13 (84%) Query: 164 RRRKAQRKVRKHM 176 RRR+AQR+ R HM Sbjct: 1160 RRRQAQRQARAHM 1172 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.318 0.136 0.426 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 332,184 Number of Sequences: 2123 Number of extensions: 14735 Number of successful extensions: 30 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 26 Number of HSP's gapped (non-prelim): 6 length of query: 315 length of database: 516,269 effective HSP length: 64 effective length of query: 251 effective length of database: 380,397 effective search space: 95479647 effective search space used: 95479647 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -