BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001487-TA|BGIBMGA001487-PA|IPR000618|Insect cuticle protein (214 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 35 0.059 SB_53929| Best HMM Match : Amelogenin (HMM E-Value=3.6) 35 0.059 SB_16587| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.69) 35 0.059 SB_43379| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_39016| Best HMM Match : Extensin_2 (HMM E-Value=0.53) 33 0.24 SB_2716| Best HMM Match : PD40 (HMM E-Value=0.00088) 32 0.31 SB_41475| Best HMM Match : HSA (HMM E-Value=7.5) 31 0.95 SB_9551| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.95 SB_48520| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_55797| Best HMM Match : HC2 (HMM E-Value=8.3) 29 2.9 SB_49841| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 28 5.1 SB_48630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_31407| Best HMM Match : TolA (HMM E-Value=2.5) 28 5.1 SB_24473| Best HMM Match : An_peroxidase (HMM E-Value=0) 28 5.1 SB_12399| Best HMM Match : DUF885 (HMM E-Value=2.3e-08) 28 5.1 SB_38880| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_4617| Best HMM Match : Extensin_2 (HMM E-Value=0.38) 28 6.7 SB_9814| Best HMM Match : DUF413 (HMM E-Value=4.4) 27 8.9 SB_30225| Best HMM Match : Peptidase_S8 (HMM E-Value=0.0034) 27 8.9 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 34.7 bits (76), Expect = 0.059 Identities = 29/102 (28%), Positives = 44/102 (43%), Gaps = 6/102 (5%) Query: 57 KESRAGDVVQGFYSLVQPDGVHRIVEYTADNEHGFNANVR--YEGHPIAQPAKIAYAAPV 114 K + +G ++ YS+V P + R T+ +++ Y G I K AY+ Sbjct: 96 KRAYSGTSIKRAYSVVHPSYIKRAYSGTSIKRAYSGTSIKRAYSGTSI----KRAYSGTS 151 Query: 115 QNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 AY+ K AYS K AY G+ K AY+ + A S Sbjct: 152 IKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 193 Score = 29.5 bits (63), Expect = 2.2 Identities = 23/68 (33%), Positives = 29/68 (42%), Gaps = 4/68 (5%) Query: 89 HGFNANVRYEGHPIAQPAKIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAP 148 HG + Y G I K AY+ AY+ K AYS K AY G+ K AY+ Sbjct: 468 HGTSIKRAYSGTYI----KRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSG 523 Query: 149 APVTYAQS 156 + A S Sbjct: 524 TYIKRAYS 531 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 6 KRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYS 55 Score = 29.1 bits (62), Expect = 2.9 Identities = 19/54 (35%), Positives = 25/54 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSPLTK 160 K AY+ AY+ K AYS K AY G+ K AY+ + A S L + Sbjct: 281 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYSNTYIKRAYSVLER 334 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 491 KRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYS 540 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 15 KRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYS 64 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 24 KRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 73 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 33 KRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 82 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 60 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYS 109 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 245 KRAYSGTSIKRAYSGTYIKRAYSDTYIKRAYSGTYIKRAYSGTSIKRAYS 294 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 254 KRAYSGTYIKRAYSDTYIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYS 303 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 500 KRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYS 549 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 509 KRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 558 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 518 KRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 567 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 662 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYS 711 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 42 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 91 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 162 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 211 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 171 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 220 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 263 KRAYSDTYIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 312 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 527 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 576 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 536 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 585 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 545 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 594 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 554 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 603 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 563 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 612 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 572 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 621 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 581 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 630 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 590 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 639 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 599 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 648 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 608 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 657 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 617 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 666 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 626 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 675 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 635 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 684 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 644 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 693 Score = 27.9 bits (59), Expect = 6.7 Identities = 17/47 (36%), Positives = 22/47 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTY 153 K AY+ AY+ K AYS K AY G+ K AY+ +Y Sbjct: 69 KRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYSVVHPSY 115 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 189 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYSGTYIKRAYS 238 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 272 KRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYS 321 Score = 27.5 bits (58), Expect = 8.9 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 51 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYS 100 Score = 27.5 bits (58), Expect = 8.9 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 180 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYS 229 Score = 27.5 bits (58), Expect = 8.9 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 653 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYS 702 Score = 27.5 bits (58), Expect = 8.9 Identities = 17/48 (35%), Positives = 22/48 (45%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYA 154 K AY+ AY+ K AYS K AY G+ K AY+ + A Sbjct: 671 KRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRA 718 >SB_53929| Best HMM Match : Amelogenin (HMM E-Value=3.6) Length = 156 Score = 34.7 bits (76), Expect = 0.059 Identities = 25/56 (44%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Query: 109 AYAAPVQ-NIAYAAPV-PKLAYSAPVTKLAYPGS-ITKVAYAPAPVTYAQSPLTKI 161 A AAPV A AAPV P A +APVT A P + +T A APVT +P ++ Sbjct: 41 ASAAPVTPTAAPAAPVTPTAAPAAPVTPTAAPAARVTPTAAPAAPVTPTAAPAARV 96 >SB_16587| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.69) Length = 404 Score = 34.7 bits (76), Expect = 0.059 Identities = 25/56 (44%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Query: 109 AYAAPVQ-NIAYAAPV-PKLAYSAPVTKLAYPGS-ITKVAYAPAPVTYAQSPLTKI 161 A AAPV A AAPV P A +APVT A P + +T A APVT +P ++ Sbjct: 198 ASAAPVTPTAAPAAPVTPTAAPAAPVTPTAAPAARVTPTAAPAAPVTPTAAPAARV 253 >SB_43379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3066 Score = 32.7 bits (71), Expect = 0.24 Identities = 17/51 (33%), Positives = 25/51 (49%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSP 157 KI Y+ + I Y+A K+ YS K+ Y S K+ Y+P+ SP Sbjct: 995 KIVYSPSGKIIVYSASGEKIVYSPSGEKIVYSPSGQKIVYSPSGEKIVYSP 1045 Score = 31.5 bits (68), Expect = 0.55 Identities = 16/54 (29%), Positives = 26/54 (48%) Query: 108 IAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSPLTKI 161 I Y+A + I Y+ K+ YS K+ Y S K+ Y+P+ P ++I Sbjct: 1005 IVYSASGEKIVYSPSGEKIVYSPSGQKIVYSPSGEKIVYSPSGERIVYLPSSEI 1058 Score = 30.7 bits (66), Expect = 0.95 Identities = 15/51 (29%), Positives = 23/51 (45%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSP 157 KI Y+ + I Y+ K+ YS K+ Y S ++ Y P+ SP Sbjct: 1085 KIVYSPSGEKIVYSPSGQKIVYSPSGEKIVYSPSGERIVYLPSSEIIVYSP 1135 Score = 30.3 bits (65), Expect = 1.3 Identities = 16/55 (29%), Positives = 25/55 (45%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSPLTKI 161 KI Y+ + I Y+ K+ YS K+ Y S K+ Y P+ SP ++ Sbjct: 1139 KIVYSPSGEIIVYSPSGKKIVYSPSGEKIVYSPSGKKIVYLPSGEQNVYSPSDEV 1193 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/51 (31%), Positives = 23/51 (45%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSP 157 KI Y+ + I Y K+ YS K+ Y S K+ Y+P+ SP Sbjct: 1067 KIVYSPSGEIIVYIPLGEKIVYSPSGEKIVYSPSGQKIVYSPSGEKIVYSP 1117 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/55 (29%), Positives = 25/55 (45%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSPLTKI 161 KI Y+ Q I Y+ K+ YS ++ Y S + Y+P+ SP +I Sbjct: 1094 KIVYSPSGQKIVYSPSGEKIVYSPSGERIVYLPSSEIIVYSPSGEKIVYSPSGEI 1148 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/51 (29%), Positives = 22/51 (43%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSP 157 KI Y+ + I Y K+ YS + Y S K+ Y+P+ SP Sbjct: 977 KIVYSPSGETIVYPPSGEKIVYSPSGKIIVYSASGEKIVYSPSGEKIVYSP 1027 Score = 29.1 bits (62), Expect = 2.9 Identities = 14/47 (29%), Positives = 22/47 (46%) Query: 103 AQPAKIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPA 149 A KI Y+ + I Y+ K+ YS K+ Y S ++ Y P+ Sbjct: 1009 ASGEKIVYSPSGEKIVYSPSGQKIVYSPSGEKIVYSPSGERIVYLPS 1055 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/50 (30%), Positives = 22/50 (44%) Query: 108 IAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSP 157 I Y + I Y+ + YSA K+ Y S K+ Y+P+ SP Sbjct: 987 IVYPPSGEKIVYSPSGKIIVYSASGEKIVYSPSGEKIVYSPSGQKIVYSP 1036 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/54 (27%), Positives = 24/54 (44%) Query: 108 IAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSPLTKI 161 I Y + I Y+ K+ YS K+ Y S K+ Y+P+ P ++I Sbjct: 1077 IVYIPLGEKIVYSPSGEKIVYSPSGQKIVYSPSGEKIVYSPSGERIVYLPSSEI 1130 >SB_39016| Best HMM Match : Extensin_2 (HMM E-Value=0.53) Length = 287 Score = 32.7 bits (71), Expect = 0.24 Identities = 24/51 (47%), Positives = 28/51 (54%), Gaps = 7/51 (13%) Query: 101 PIAQPAKIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPV 151 P+A PA++A AAP A APVP A AP A P + A APAPV Sbjct: 86 PLAAPAQVA-AAPAPAAAAPAPVPAAAAPAPAP--AAPSA----AAAPAPV 129 >SB_2716| Best HMM Match : PD40 (HMM E-Value=0.00088) Length = 248 Score = 32.3 bits (70), Expect = 0.31 Identities = 16/51 (31%), Positives = 23/51 (45%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSP 157 KI Y+ + I Y+ K+ YS K+ Y S K+ Y P+ SP Sbjct: 66 KIVYSPSGEKIVYSPSGEKIVYSPSGEKIVYSSSGEKIVYLPSGEIIVYSP 116 Score = 30.7 bits (66), Expect = 0.95 Identities = 17/54 (31%), Positives = 25/54 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSPLTK 160 KI Y+ + I Y+ K+ YS K+ Y S K+ Y+P+ SP K Sbjct: 120 KIVYSPSGEKIFYSPSGEKIFYSPSGEKIVYSPSGEKIIYSPSGEIIVYSPSGK 173 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/51 (29%), Positives = 24/51 (47%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSP 157 KI Y+ + I Y+ K+ YS+ K+ Y S + Y+P+ SP Sbjct: 75 KIVYSPSGEKIVYSPSGEKIVYSSSGEKIVYLPSGEIIVYSPSSEKIVYSP 125 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/51 (31%), Positives = 23/51 (45%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSP 157 KI Y + I Y+ K+ YS K+ Y S K+ Y+P+ SP Sbjct: 102 KIVYLPSGEIIVYSPSSEKIVYSPSGEKIFYSPSGEKIFYSPSGEKIVYSP 152 Score = 29.1 bits (62), Expect = 2.9 Identities = 16/54 (29%), Positives = 25/54 (46%) Query: 108 IAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSPLTKI 161 I Y+ + I Y+ K+ YS K+ Y S K+ Y+P+ SP +I Sbjct: 112 IVYSPSSEKIVYSPSGEKIFYSPSGEKIFYSPSGEKIVYSPSGEKIIYSPSGEI 165 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/52 (30%), Positives = 24/52 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSPL 158 KI Y+ + I Y+A K+ YS + Y S K+ Y+P+ PL Sbjct: 12 KIVYSPSGKIIVYSASGEKIVYSPSGEIIVYSPSGEKIVYSPSGEIIVYIPL 63 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPA---PVTYAQSPLTK 160 KI Y+ + I Y+ K+ YS ++ Y S K+ Y P+ P +SP+ K Sbjct: 156 KIIYSPSGEIIVYSPSGKKIVYSPSGEEIVYSPSGEKIVYLPSDEVPSCIPESPVEK 212 Score = 28.3 bits (60), Expect = 5.1 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPA--PVTYAQS 156 KI Y+ + I Y K+ YS K+ Y S K+ Y+P+ + Y+ S Sbjct: 48 KIVYSPSGEIIVYIPLGEKIVYSPSGEKIVYSPSGEKIVYSPSGEKIVYSSS 99 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/51 (29%), Positives = 23/51 (45%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSP 157 KI Y++ + I Y + YS K+ Y S K+ Y+P+ SP Sbjct: 93 KIVYSSSGEKIVYLPSGEIIVYSPSSEKIVYSPSGEKIFYSPSGEKIFYSP 143 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/51 (29%), Positives = 23/51 (45%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSP 157 KI Y+ + I Y+ K+ YS + Y S K+ Y+P+ SP Sbjct: 138 KIFYSPSGEKIVYSPSGEKIIYSPSGEIIVYSPSGKKIVYSPSGEEIVYSP 188 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/51 (27%), Positives = 23/51 (45%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSP 157 KI Y+ + I Y++ K+ Y + Y S K+ Y+P+ SP Sbjct: 84 KIVYSPSGEKIVYSSSGEKIVYLPSGEIIVYSPSSEKIVYSPSGEKIFYSP 134 >SB_41475| Best HMM Match : HSA (HMM E-Value=7.5) Length = 195 Score = 30.7 bits (66), Expect = 0.95 Identities = 19/66 (28%), Positives = 27/66 (40%) Query: 33 HEAPAHYDFEYSVHDDHSGDIKQQKESRAGDVVQGFYSLVQPDGVHRIVEYTADNEHGFN 92 HE H EY VH H +++ E R V + V VHR+ EY H + Sbjct: 119 HEYRVHRVHEYRVHRVHEYRVRRVHEYRVHRVHEYRVHRVHEYRVHRVHEYRVHRVHEYR 178 Query: 93 ANVRYE 98 + +E Sbjct: 179 VHRVHE 184 Score = 29.5 bits (63), Expect = 2.2 Identities = 19/66 (28%), Positives = 26/66 (39%) Query: 33 HEAPAHYDFEYSVHDDHSGDIKQQKESRAGDVVQGFYSLVQPDGVHRIVEYTADNEHGFN 92 HE H EY VH H + + E R V + V VHR+ EY H + Sbjct: 111 HEYRVHRVHEYRVHRVHEYRVHRVHEYRVRRVHEYRVHRVHEYRVHRVHEYRVHRVHEYR 170 Query: 93 ANVRYE 98 + +E Sbjct: 171 VHRVHE 176 >SB_9551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 221 Score = 30.7 bits (66), Expect = 0.95 Identities = 19/52 (36%), Positives = 24/52 (46%) Query: 105 PAKIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 P K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 34 PIKRAYSGTSIKRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYSGTYIKRAYS 85 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 54 KRAYSGTYIKRAYSGTSIKRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYS 103 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 27 KRAYSGTPIKRAYSGTSIKRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYS 76 Score = 29.1 bits (62), Expect = 2.9 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 5/65 (7%) Query: 97 YEGHPIAQP-----AKIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPV 151 Y G PI + K AY+ AY+ K AYS K AY G+ K AY+ + Sbjct: 30 YSGTPIKRAYSGTSIKRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYSGTYIKRAYSGTYI 89 Query: 152 TYAQS 156 A S Sbjct: 90 KRAYS 94 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 63 KRAYSGTSIKRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYS 112 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 81 KRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYS 130 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 90 KRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYS 139 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 99 KRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 148 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 108 KRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 157 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 18 KRAYSGTYIKRAYSGTPIKRAYSGTSIKRAYSGTYIKRAYSGTYIKRAYS 67 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 72 KRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYS 121 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 117 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 166 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 126 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 175 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 135 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 184 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 144 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 193 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 153 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 202 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 162 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 211 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 171 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 220 >SB_48520| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 29.9 bits (64), Expect = 1.7 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 15 KRAYSGTYIKRAYSGTYIKRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYS 64 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 42 KRAYSGTYIKRAYSGTSIKRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYS 91 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 69 KRAYSGTYIKRAYSGTSIKRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYS 118 Score = 29.5 bits (63), Expect = 2.2 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 123 KRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYS 172 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 6 KRAYSGTYIKRAYSGTYIKRAYSGTYIKRAYSGTYIKRAYSGTYIKRAYS 55 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 78 KRAYSGTSIKRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYS 127 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 105 KRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYS 154 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 132 KRAYSGTYIKRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYS 181 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 24 KRAYSGTYIKRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYSGTYIKRAYS 73 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 33 KRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYSGTYIKRAYSGTYIKRAYS 82 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 60 KRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYSGTYIKRAYSGTYIKRAYS 109 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 141 KRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 190 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 51 KRAYSGTSIKRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYSGTYIKRAYS 100 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 87 KRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYS 136 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 96 KRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSGTYIKRAYSGTYIKRAYS 145 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 114 KRAYSGTSIKRAYSGTYIKRAYSGTYIKRAYSGTSIKRAYSGTYIKRAYS 163 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 150 KRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSDTYIKRAYS 199 >SB_55797| Best HMM Match : HC2 (HMM E-Value=8.3) Length = 317 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/52 (34%), Positives = 23/52 (44%) Query: 105 PAKIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 P K AY+ AY+ K AY K AY G+ K AY+ + A S Sbjct: 40 PIKRAYSGTSIKRAYSGTSIKRAYCGTSIKRAYSGTYIKRAYSGTSIKRAYS 91 Score = 29.1 bits (62), Expect = 2.9 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 69 KRAYSGTYIKRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYS 118 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/50 (36%), Positives = 22/50 (44%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY AY+ K AYS K AY G+ K AY+ + A S Sbjct: 60 KRAYCGTSIKRAYSGTYIKRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYS 109 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 78 KRAYSGTSIKRAYSGTYIKRAYSGTSIKRAYSGTSIKRAYSDTYIKRAYS 127 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 123 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 172 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 132 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 181 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 141 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 190 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 150 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 199 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 159 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 208 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 168 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 217 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 177 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 226 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 186 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 235 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 195 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 244 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 204 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 253 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 213 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 262 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 222 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 271 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 231 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 280 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 240 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 289 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 249 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 298 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 258 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 307 Score = 28.3 bits (60), Expect = 5.1 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 267 KRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 316 Score = 27.9 bits (59), Expect = 6.7 Identities = 22/65 (33%), Positives = 27/65 (41%), Gaps = 5/65 (7%) Query: 97 YEGHPIAQP-----AKIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPV 151 Y G PI + K AY+ AY K AYS K AY G+ K AY+ + Sbjct: 36 YSGTPIKRAYSGTSIKRAYSGTSIKRAYCGTSIKRAYSGTYIKRAYSGTSIKRAYSGTYI 95 Query: 152 TYAQS 156 A S Sbjct: 96 KRAYS 100 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 96 KRAYSGTSIKRAYSGTSIKRAYSDTYIKRAYSGTSIKRAYSGTSIKRAYS 145 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 105 KRAYSGTSIKRAYSDTYIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 154 Score = 27.9 bits (59), Expect = 6.7 Identities = 18/50 (36%), Positives = 23/50 (46%) Query: 107 KIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQS 156 K AY+ AY+ K AYS K AY G+ K AY+ + A S Sbjct: 114 KRAYSDTYIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYSGTSIKRAYS 163 >SB_49841| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 1841 Score = 28.3 bits (60), Expect = 5.1 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 104 QPAKIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVTYAQSPL 158 +P + +APVQ + P+P + Y APV + V YAP PL Sbjct: 1420 EPRPVVPSAPVQLVVGMEPLPVVPY-APVQLVVGMEPCPVVPYAPVQPMVGMEPL 1473 >SB_48630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 28.3 bits (60), Expect = 5.1 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 7/76 (9%) Query: 83 YTADNEHGFNAN-VRYEGHPIAQPAKIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSI 141 Y+A ++GF+ N Y HP+ P Y Q + VP L ++ P T A + Sbjct: 2 YSAPVQYGFDNNSCSYPVHPVVNP----YG--YQPAGLYSTVPPLHHNPPTTTAASQYNG 55 Query: 142 TKVAYAPAPVTYAQSP 157 T+ P P+++ P Sbjct: 56 TEYNTYPPPLSHPNDP 71 >SB_31407| Best HMM Match : TolA (HMM E-Value=2.5) Length = 315 Score = 28.3 bits (60), Expect = 5.1 Identities = 11/54 (20%), Positives = 24/54 (44%) Query: 52 DIKQQKESRAGDVVQGFYSLVQPDGVHRIVEYTADNEHGFNANVRYEGHPIAQP 105 ++K+ + ++ + PD + + + Y +NE +N + EG QP Sbjct: 150 ELKEMRIEIVNKAIEESKEFITPDNLDKKIAYALENETNYNFALTPEGKSFIQP 203 >SB_24473| Best HMM Match : An_peroxidase (HMM E-Value=0) Length = 647 Score = 28.3 bits (60), Expect = 5.1 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Query: 94 NVRYEGHPIAQPAKIAYAAPVQNIAYAAPVPKLAYSAPVTKLA-YPG 139 N + G I A+ A +Q+I Y+A +PK+ + +L YPG Sbjct: 404 NPHWTGEKIYHEARKIVGAQLQHITYSAWIPKIVGPKGMARLGPYPG 450 >SB_12399| Best HMM Match : DUF885 (HMM E-Value=2.3e-08) Length = 718 Score = 28.3 bits (60), Expect = 5.1 Identities = 13/43 (30%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Query: 108 IAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAP 150 I Y P+ I Y P + Y P + YP + Y P P Sbjct: 538 ITYPVPLMVITYPVPFMVITYPVPFMVITYPVPFMVITY-PVP 579 >SB_38880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 821 Score = 27.9 bits (59), Expect = 6.7 Identities = 16/65 (24%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Query: 96 RYEGHPIAQPAKIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAY-APAPVTYA 154 +++ HP+A P + Y P L Y + T L Y T + Y +P+ + Sbjct: 174 KWQCHPVAMPTNSTLSNGTLEFVYDLPSTLLVYDSSSTLLVYDLPSTLLVYDSPSTLLVY 233 Query: 155 QSPLT 159 P T Sbjct: 234 DLPYT 238 >SB_4617| Best HMM Match : Extensin_2 (HMM E-Value=0.38) Length = 450 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Query: 103 AQPAKIAYAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAY-APAPVTYAQSP 157 A A+ A++ P ++ P P++ A + ++PGS+++ + A + Y QSP Sbjct: 126 ALAAQQAHSQPAVSLPQPHPSPQMPSPAQLGAQSHPGSVSQQMHAAQTRMQYVQSP 181 >SB_9814| Best HMM Match : DUF413 (HMM E-Value=4.4) Length = 422 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Query: 42 EYSVHDDHSGDIKQQKESRAGD 63 +Y V DDH GD + R GD Sbjct: 397 DYDVSDDHGGDDYDDSDDRGGD 418 >SB_30225| Best HMM Match : Peptidase_S8 (HMM E-Value=0.0034) Length = 605 Score = 27.5 bits (58), Expect = 8.9 Identities = 18/51 (35%), Positives = 22/51 (43%), Gaps = 2/51 (3%) Query: 103 AQPAKIA-YAAPVQNIAYAAPVPKLAYSAPVTKLAYPGSITKVAYAPAPVT 152 A+PA+ Y AP + Y PVP A A P + VA P VT Sbjct: 388 AKPAQYTQYTAPAP-VVYNPPVPPKALPAAAPHYEKPADQSTVAQVPVEVT 437 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.317 0.132 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,555,313 Number of Sequences: 59808 Number of extensions: 211182 Number of successful extensions: 650 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 10 Number of HSP's that attempted gapping in prelim test: 454 Number of HSP's gapped (non-prelim): 185 length of query: 214 length of database: 16,821,457 effective HSP length: 79 effective length of query: 135 effective length of database: 12,096,625 effective search space: 1633044375 effective search space used: 1633044375 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 58 (27.5 bits)
- SilkBase 1999-2023 -