BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001486-TA|BGIBMGA001486-PA|IPR000618|Insect cuticle protein (265 letters) Database: celegans 27,539 sequences; 12,573,161 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U58753-1|AAC24437.2| 814|Caenorhabditis elegans Hypothetical pr... 29 2.6 AC024817-14|AAY86301.1| 354|Caenorhabditis elegans Hypothetical... 28 6.0 >U58753-1|AAC24437.2| 814|Caenorhabditis elegans Hypothetical protein W03B1.2 protein. Length = 814 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 105 AYAEHEAPAHYDFEYSVHDEQSGDIKQQKESRAGDAVQGFYSLVQPDGVHRI 156 AY+ YDF S+ E +K+Q E A V Y L +PDG ++ Sbjct: 161 AYSMRNTQEKYDFGQSLKQETYEALKEQLEKLACKIVNNLY-LSEPDGPFQV 211 >AC024817-14|AAY86301.1| 354|Caenorhabditis elegans Hypothetical protein Y54G2A.45 protein. Length = 354 Score = 28.3 bits (60), Expect = 6.0 Identities = 9/17 (52%), Positives = 12/17 (70%) Query: 62 ICNLPACHKPLKSVINC 78 +CN PAC +K V+NC Sbjct: 37 LCNTPACVNTIKEVLNC 53 Database: celegans Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 12,573,161 Number of sequences in database: 27,539 Lambda K H 0.321 0.133 0.404 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,208,217 Number of Sequences: 27539 Number of extensions: 184372 Number of successful extensions: 396 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 395 Number of HSP's gapped (non-prelim): 2 length of query: 265 length of database: 12,573,161 effective HSP length: 80 effective length of query: 185 effective length of database: 10,370,041 effective search space: 1918457585 effective search space used: 1918457585 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -