BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001485-TA|BGIBMGA001485-PA|undefined (65 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5416| Best HMM Match : Peptidase_S9 (HMM E-Value=3.8e-24) 26 3.7 >SB_5416| Best HMM Match : Peptidase_S9 (HMM E-Value=3.8e-24) Length = 637 Score = 26.2 bits (55), Expect = 3.7 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 6/70 (8%) Query: 2 KNKAEXXXXXXXXXXLILRHGGLCEST--ISKTQVSVTVGRG----EFNPNGQSTLTEEF 55 KNK L+ HGG +T +V RG + N G ++ EF Sbjct: 405 KNKDYAAPEGALPPLLVKVHGGPTSATNPCLDLEVQYFTSRGIGILDVNYRGSTSYGREF 464 Query: 56 ESKLRMSWGM 65 ++LR +WG+ Sbjct: 465 RNQLRQNWGI 474 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.312 0.128 0.366 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,674,978 Number of Sequences: 59808 Number of extensions: 38600 Number of successful extensions: 46 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 45 Number of HSP's gapped (non-prelim): 1 length of query: 65 length of database: 16,821,457 effective HSP length: 44 effective length of query: 21 effective length of database: 14,189,905 effective search space: 297988005 effective search space used: 297988005 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -