GeneModel BLAST Result against nematostella

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001485-TA|BGIBMGA001485-PA|undefined
         (65 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_5416| Best HMM Match : Peptidase_S9 (HMM E-Value=3.8e-24)           26   3.7  

>SB_5416| Best HMM Match : Peptidase_S9 (HMM E-Value=3.8e-24)
          Length = 637

 Score = 26.2 bits (55), Expect = 3.7
 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 6/70 (8%)

Query: 2   KNKAEXXXXXXXXXXLILRHGGLCEST--ISKTQVSVTVGRG----EFNPNGQSTLTEEF 55
           KNK            L+  HGG   +T      +V     RG    + N  G ++   EF
Sbjct: 405 KNKDYAAPEGALPPLLVKVHGGPTSATNPCLDLEVQYFTSRGIGILDVNYRGSTSYGREF 464

Query: 56  ESKLRMSWGM 65
            ++LR +WG+
Sbjct: 465 RNQLRQNWGI 474


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.312    0.128    0.366 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,674,978
Number of Sequences: 59808
Number of extensions: 38600
Number of successful extensions: 46
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 45
Number of HSP's gapped (non-prelim): 1
length of query: 65
length of database: 16,821,457
effective HSP length: 44
effective length of query: 21
effective length of database: 14,189,905
effective search space: 297988005
effective search space used: 297988005
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 42 (21.9 bits)
S2: 52 (25.0 bits)