BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001484-TA|BGIBMGA001484-PA|IPR001607|Zinc finger, UBP-type, IPR001394|Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 (481 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 25 1.6 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 22 8.3 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 22 8.3 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 24.6 bits (51), Expect = 1.6 Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Query: 234 NLGNTCFMNAVLQSLNNIQEFSCYFNQLPSLEMKANGRKVYHSRSYTRQEMNDV 287 NL N S N+ S FN LP++ ++ G S Y + ND+ Sbjct: 451 NLDNVSLSQVPALSTPNLLSLSLAFNSLPTVALEVAGN--ISSLRYLNLDYNDL 502 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Query: 365 WIRRLPNVLCLHLKRFRWHNYFRT 388 W+ + N L L LKR +W+ F+T Sbjct: 146 WLSNV-NSLTLTLKRKKWNLLFKT 168 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 1/24 (4%) Query: 365 WIRRLPNVLCLHLKRFRWHNYFRT 388 W+ + N L L LKR +W+ F+T Sbjct: 72 WLSNV-NSLTLTLKRKKWNLLFKT 94 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.133 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,394 Number of Sequences: 317 Number of extensions: 4739 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 3 length of query: 481 length of database: 114,650 effective HSP length: 59 effective length of query: 422 effective length of database: 95,947 effective search space: 40489634 effective search space used: 40489634 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -