BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001483-TA|BGIBMGA001483-PA|IPR001210|Ribosomal protein S17e (139 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 23 0.77 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 3.1 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 23.4 bits (48), Expect = 0.77 Identities = 9/28 (32%), Positives = 17/28 (60%) Query: 77 IKLQEEERERRDNYVPEVSALEHDIIEV 104 IK+ E+ E RD+++ L +D +E+ Sbjct: 174 IKIDREDEEARDDFIKLGIKLSNDKLEI 201 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 21.4 bits (43), Expect = 3.1 Identities = 9/40 (22%), Positives = 22/40 (55%) Query: 76 SIKLQEEERERRDNYVPEVSALEHDIIEVDPDTKDMLKML 115 ++K +E++ ++ + + D+I+V+P+ D K L Sbjct: 265 AVKRKEKKAQKEKDKPNSTTNGSPDVIKVEPELSDSEKTL 304 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.138 0.399 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,465 Number of Sequences: 317 Number of extensions: 1038 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 139 length of database: 114,650 effective HSP length: 51 effective length of query: 88 effective length of database: 98,483 effective search space: 8666504 effective search space used: 8666504 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.9 bits) S2: 39 (19.8 bits)
- SilkBase 1999-2023 -