BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001482-TA|BGIBMGA001482-PA|undefined (79 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC093004-1|AAH93004.1| 76|Homo sapiens putative NFkB activatin... 43 2e-04 BC022357-1|AAH22357.1| 76|Homo sapiens LOC497661 protein protein. 43 2e-04 AB097012-1|BAC77365.1| 76|Homo sapiens putative NFkB activatin... 43 2e-04 BC070305-1|AAH70305.1| 85|Homo sapiens SRP9 protein protein. 30 1.3 BX255972-5|CAH73103.1| 402|Homo sapiens protein kinase C and ca... 29 3.0 BX255972-4|CAH73102.1| 444|Homo sapiens protein kinase C and ca... 29 3.0 BC128219-1|AAI28220.1| 306|Homo sapiens C21orf93 protein protein. 29 3.0 BC040228-1|AAH40228.1| 444|Homo sapiens PACSIN1 protein protein. 29 3.0 AF242529-1|AAK29206.1| 444|Homo sapiens protein kinase C and ca... 29 3.0 AB037800-1|BAA92617.2| 457|Homo sapiens KIAA1379 protein protein. 29 3.0 >BC093004-1|AAH93004.1| 76|Homo sapiens putative NFkB activating protein protein. Length = 76 Score = 42.7 bits (96), Expect = 2e-04 Identities = 14/31 (45%), Positives = 25/31 (80%) Query: 1 MVCVPCFIIPLLLFLWHRFVQPYILRFWNPW 31 MVC+PC +IP+LL+++ +F++PYI +P+ Sbjct: 1 MVCIPCIVIPVLLWIYKKFLEPYIYPLVSPF 31 >BC022357-1|AAH22357.1| 76|Homo sapiens LOC497661 protein protein. Length = 76 Score = 42.7 bits (96), Expect = 2e-04 Identities = 14/31 (45%), Positives = 25/31 (80%) Query: 1 MVCVPCFIIPLLLFLWHRFVQPYILRFWNPW 31 MVC+PC +IP+LL+++ +F++PYI +P+ Sbjct: 1 MVCIPCIVIPVLLWIYKKFLEPYIYPLVSPF 31 >AB097012-1|BAC77365.1| 76|Homo sapiens putative NFkB activating protein protein. Length = 76 Score = 42.7 bits (96), Expect = 2e-04 Identities = 14/31 (45%), Positives = 25/31 (80%) Query: 1 MVCVPCFIIPLLLFLWHRFVQPYILRFWNPW 31 MVC+PC +IP+LL+++ +F++PYI +P+ Sbjct: 1 MVCIPCIVIPVLLWIYKKFLEPYIYPLVSPF 31 >BC070305-1|AAH70305.1| 85|Homo sapiens SRP9 protein protein. Length = 85 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/28 (42%), Positives = 19/28 (67%) Query: 52 GVCVFARNKNTENSTSNEADQSEDQKTK 79 G+ + +N+N ENS S+ +D SED+ K Sbjct: 25 GLSIEEKNENDENSLSSSSDSSEDKDEK 52 >BX255972-5|CAH73103.1| 402|Homo sapiens protein kinase C and casein kinase substrate in neurons 1 protein. Length = 402 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/50 (28%), Positives = 21/50 (42%) Query: 30 PWAVKDKDGNVMKTEFPFQCKEGVCVFARNKNTENSTSNEADQSEDQKTK 79 PWA K K+ K + CKE R N++ S +Q + + K Sbjct: 103 PWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDK 152 >BX255972-4|CAH73102.1| 444|Homo sapiens protein kinase C and casein kinase substrate in neurons 1 protein. Length = 444 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/50 (28%), Positives = 21/50 (42%) Query: 30 PWAVKDKDGNVMKTEFPFQCKEGVCVFARNKNTENSTSNEADQSEDQKTK 79 PWA K K+ K + CKE R N++ S +Q + + K Sbjct: 145 PWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDK 194 >BC128219-1|AAI28220.1| 306|Homo sapiens C21orf93 protein protein. Length = 306 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/50 (28%), Positives = 21/50 (42%) Query: 30 PWAVKDKDGNVMKTEFPFQCKEGVCVFARNKNTENSTSNEADQSEDQKTK 79 PWA K K+ K + CKE R N++ S +Q + + K Sbjct: 29 PWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDK 78 >BC040228-1|AAH40228.1| 444|Homo sapiens PACSIN1 protein protein. Length = 444 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/50 (28%), Positives = 21/50 (42%) Query: 30 PWAVKDKDGNVMKTEFPFQCKEGVCVFARNKNTENSTSNEADQSEDQKTK 79 PWA K K+ K + CKE R N++ S +Q + + K Sbjct: 145 PWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDK 194 >AF242529-1|AAK29206.1| 444|Homo sapiens protein kinase C and casein kinase substrate 1 protein. Length = 444 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/50 (28%), Positives = 21/50 (42%) Query: 30 PWAVKDKDGNVMKTEFPFQCKEGVCVFARNKNTENSTSNEADQSEDQKTK 79 PWA K K+ K + CKE R N++ S +Q + + K Sbjct: 145 PWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDK 194 >AB037800-1|BAA92617.2| 457|Homo sapiens KIAA1379 protein protein. Length = 457 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/50 (28%), Positives = 21/50 (42%) Query: 30 PWAVKDKDGNVMKTEFPFQCKEGVCVFARNKNTENSTSNEADQSEDQKTK 79 PWA K K+ K + CKE R N++ S +Q + + K Sbjct: 158 PWAKKMKELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDK 207 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.325 0.138 0.468 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,321,170 Number of Sequences: 224733 Number of extensions: 446732 Number of successful extensions: 1183 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1173 Number of HSP's gapped (non-prelim): 10 length of query: 79 length of database: 73,234,838 effective HSP length: 58 effective length of query: 21 effective length of database: 60,200,324 effective search space: 1264206804 effective search space used: 1264206804 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -