BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001481-TA|BGIBMGA001481-PA|IPR005033|YEATS (238 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12094| Best HMM Match : Myb_DNA-binding (HMM E-Value=0.00041) 30 1.5 SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) 29 2.6 >SB_12094| Best HMM Match : Myb_DNA-binding (HMM E-Value=0.00041) Length = 754 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Query: 58 KKIQLKYSLQIEN-NTKSSSESRCIYYDFEKPSEQLCRALMSGGGELIARARAKHLLE 114 ++ QLKY Q+E NT++ + KP +Q AL G G L + + + LLE Sbjct: 497 EECQLKYQGQLEQRNTRAYNRPERAAKPSAKPKDQKITALCGGVGTLKRKRQLRQLLE 554 >SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 1831 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/30 (40%), Positives = 18/30 (60%) Query: 32 PYEIQESGCASIEIPIQIYLKYSSRPKKIQ 61 P E QE+ + E+PI+ +L Y +R K Q Sbjct: 1018 PQETQETSAQATEVPIEEFLDYFNRAKSTQ 1047 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.132 0.374 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,598,929 Number of Sequences: 59808 Number of extensions: 276947 Number of successful extensions: 596 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 594 Number of HSP's gapped (non-prelim): 3 length of query: 238 length of database: 16,821,457 effective HSP length: 80 effective length of query: 158 effective length of database: 12,036,817 effective search space: 1901817086 effective search space used: 1901817086 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -