Silkworm BLAST Result against arabidopsis

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001480-TA|BGIBMGA001480-PA|IPR002557|Chitin binding
Peritrophin-A
         (289 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g11820.1 68418.m01380 expressed protein self-incompatibility ...    32   0.52 

>At5g11820.1 68418.m01380 expressed protein self-incompatibility
           protein S3 precursor, Papaver rhoeas cv., PIR:S69186
          Length = 175

 Score = 31.9 bits (69), Expect = 0.52
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 5/60 (8%)

Query: 22  PEQSENWEIE-LLLPHPQCNKFYKCTF----GQPVEMVCYGNLYFNLKTWQCDWPENVEC 76
           P QS++W  + + +  P    +++CTF    G P            L  WQCD P+  EC
Sbjct: 71  PGQSKSWSFKPIFIKIPFFYTYFECTFFTAFGSPFGQTATVFAGERLFRWQCDNPDEEEC 130


  Database: arabidopsis
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.324    0.141    0.518 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 4,324,480
Number of Sequences: 28952
Number of extensions: 156844
Number of successful extensions: 274
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 274
Number of HSP's gapped (non-prelim): 1
length of query: 289
length of database: 12,070,560
effective HSP length: 80
effective length of query: 209
effective length of database: 9,754,400
effective search space: 2038669600
effective search space used: 2038669600
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.5 bits)
S2: 59 (27.9 bits)