BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001479-TA|BGIBMGA001479-PA|undefined (480 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 31 0.013 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 23 3.6 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 31.5 bits (68), Expect = 0.013 Identities = 20/72 (27%), Positives = 29/72 (40%), Gaps = 8/72 (11%) Query: 4 VTAQGDCSDLRGRVISHGIHYVPGPNSCNLCICDNGLPK----DCKVVLCSPPQDCRSFR 59 V GDC + + N C C C+NG K +C V C P + + + Sbjct: 667 VGPSGDCF-YENKFYRQEAQWTSSDNPCTTCFCENGNNKCFTMECPQVTC--PDNMKLEK 723 Query: 60 VGNNCCEFICLD 71 V CC IC++ Sbjct: 724 VPGECCA-ICVN 734 Score = 23.8 bits (49), Expect = 2.7 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 10/56 (17%) Query: 4 VTAQGDCSDLRG--RVISHGIHYVP-----GPNSCNLCICDNGLP---KDCKVVLC 49 + A+G C +L + +G Y P G C C C+NG P ++C C Sbjct: 839 ILAEGGCPNLYDARKPYVNGSEYHPSIVSLGEYKCVTCKCENGKPTCWRECDKATC 894 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 23.4 bits (48), Expect = 3.6 Identities = 9/25 (36%), Positives = 14/25 (56%) Query: 32 NLCICDNGLPKDCKVVLCSPPQDCR 56 N+ C NGL + K +CS P + + Sbjct: 134 NMITCPNGLVYNDKAGICSWPDEAK 158 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.138 0.446 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,911 Number of Sequences: 317 Number of extensions: 4829 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 3 length of query: 480 length of database: 114,650 effective HSP length: 59 effective length of query: 421 effective length of database: 95,947 effective search space: 40393687 effective search space used: 40393687 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -