BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001478-TA|BGIBMGA001478-PA|undefined (824 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein... 27 2.0 AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 27 2.0 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 25 8.0 >Y17700-1|CAA76820.1| 122|Anopheles gambiae hypothetical protein protein. Length = 122 Score = 27.1 bits (57), Expect = 2.0 Identities = 12/35 (34%), Positives = 21/35 (60%) Query: 1 MKNGCLDLSEAKIAERNERAKKLYRYLSDVARRIN 35 +K C + + + A+ N +KL YLS+V+ R+N Sbjct: 73 LKQRCQEAHDERTAKVNAIYEKLPAYLSEVSARVN 107 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 27.1 bits (57), Expect = 2.0 Identities = 23/86 (26%), Positives = 36/86 (41%), Gaps = 5/86 (5%) Query: 460 LILSCGDSGESLFQCVVDLLNIFTFYFNTKSDEGTKEDCELIKYIR----NLVMKMKLEY 515 ++ S G S +D +I FN EG + D IR +V K + + Sbjct: 205 IVASAGSLKRSQLGSFIDEHDI-VMRFNHAPTEGYEADVGSKTTIRVVNSQVVTKPEYQL 263 Query: 516 KTIPLPEDINLRGTNICKFDKDAAEW 541 T PL ++ + + KFD+ AEW Sbjct: 264 LTAPLFRNVTIAAWDPGKFDQTLAEW 289 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 25.0 bits (52), Expect = 8.0 Identities = 9/12 (75%), Positives = 10/12 (83%) Query: 806 IVDFYSKWRQTS 817 + DFYS WRQTS Sbjct: 97 LYDFYSYWRQTS 108 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.317 0.133 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 694,753 Number of Sequences: 2123 Number of extensions: 26488 Number of successful extensions: 60 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 58 Number of HSP's gapped (non-prelim): 3 length of query: 824 length of database: 516,269 effective HSP length: 70 effective length of query: 754 effective length of database: 367,659 effective search space: 277214886 effective search space used: 277214886 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 52 (25.0 bits)
- SilkBase 1999-2023 -