BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001478-TA|BGIBMGA001478-PA|undefined (824 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g34355.1 68414.m04265 forkhead-associated domain-containing p... 35 0.25 At5g18410.2 68418.m02167 expressed protein similar to p53 induci... 31 2.4 At5g18410.1 68418.m02166 expressed protein similar to p53 induci... 31 2.4 At3g09130.1 68416.m01074 hypothetical protein 31 4.1 At3g06530.1 68416.m00757 BAP28-related similar to Protein BAP28 ... 30 7.2 >At1g34355.1 68414.m04265 forkhead-associated domain-containing protein / FHA domain-containing protein Length = 1477 Score = 34.7 bits (76), Expect = 0.25 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 10/81 (12%) Query: 648 LVLDTAAL-NKHLRRVKQLLLTTNFV-LMVPTVVLQELDNLKREQS--------TARKAI 697 +VLDT++L +K R+ QLL L+VP VL+EL+ +KR +S A A+ Sbjct: 1239 IVLDTSSLLDKESRKPLQLLQGLKGTHLVVPRTVLRELNEVKRSRSFLFRRRTEIASSAL 1298 Query: 698 RWLELQLKNGSRFLRAQRPNQ 718 W+E N +++ Q P + Sbjct: 1299 DWIEECKVNSKWWIQVQSPTE 1319 >At5g18410.2 68418.m02167 expressed protein similar to p53 inducible protein [Homo sapiens] GI:5616320 Length = 1017 Score = 31.5 bits (68), Expect = 2.4 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 1/69 (1%) Query: 631 SQVRELERSGQSAAPALLVLDTAALNKHLRRVKQLLLTTNFVLMVPTVVLQELDNLKREQ 690 S++RE++R QS+A A L D ++ RR+ +T + ++ VL +LD+LK + Sbjct: 115 SRLREIQR-WQSSASAKLAADMQRFSRPERRINGPTVTHLWSMLKLLDVLVQLDHLKNAK 173 Query: 691 STARKAIRW 699 ++ W Sbjct: 174 ASIPNDFSW 182 >At5g18410.1 68418.m02166 expressed protein similar to p53 inducible protein [Homo sapiens] GI:5616320 Length = 1234 Score = 31.5 bits (68), Expect = 2.4 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 1/69 (1%) Query: 631 SQVRELERSGQSAAPALLVLDTAALNKHLRRVKQLLLTTNFVLMVPTVVLQELDNLKREQ 690 S++RE++R QS+A A L D ++ RR+ +T + ++ VL +LD+LK + Sbjct: 115 SRLREIQR-WQSSASAKLAADMQRFSRPERRINGPTVTHLWSMLKLLDVLVQLDHLKNAK 173 Query: 691 STARKAIRW 699 ++ W Sbjct: 174 ASIPNDFSW 182 >At3g09130.1 68416.m01074 hypothetical protein Length = 397 Score = 30.7 bits (66), Expect = 4.1 Identities = 16/47 (34%), Positives = 26/47 (55%) Query: 147 IPQRCSKIAQQLKICMEFNEATLPDIDKNYDDYLSILEHETNFPSYL 193 I Q CS+ A+++ IC+ F+ A L + K S++ TN SY+ Sbjct: 327 IAQWCSQNAEKVAICLGFHTALLENAGKFPGPSYSLMVLRTNVDSYI 373 >At3g06530.1 68416.m00757 BAP28-related similar to Protein BAP28 (Swiss-Prot:Q9H583) [Homo sapiens] Length = 1830 Score = 29.9 bits (64), Expect = 7.2 Identities = 16/64 (25%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Query: 84 RKVYYDTISTAKKLRTDSEHDHFLFTLIQCGIDTLTQVE-HIQNTIVNFLSLIEIWYLNK 142 R + + K D DH + L G T+TQ++ H ++ F+S++ ++L+K Sbjct: 1156 RNHIFSLFTAIVKFVPDKVLDHIISILTLVGESTVTQIDSHSKSIFEGFISMVIPFWLSK 1215 Query: 143 SDSD 146 + S+ Sbjct: 1216 TKSE 1219 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.133 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,317,380 Number of Sequences: 28952 Number of extensions: 635439 Number of successful extensions: 1642 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 1641 Number of HSP's gapped (non-prelim): 6 length of query: 824 length of database: 12,070,560 effective HSP length: 87 effective length of query: 737 effective length of database: 9,551,736 effective search space: 7039629432 effective search space used: 7039629432 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 63 (29.5 bits)
- SilkBase 1999-2023 -