BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001476-TA|BGIBMGA001476-PA|IPR006620|Prolyl 4-hydroxylase, alpha subunit, IPR008162|Inorganic pyrophosphatase (317 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 23 2.2 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 22 6.8 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/27 (33%), Positives = 15/27 (55%) Query: 179 KIKYSIGHYFGVNPERIYLTHPTFFSE 205 +I ++IG +F + P I L TF + Sbjct: 7 QIMFTIGKFFALTPRSIKLEKQTFIQK 33 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 21.8 bits (44), Expect = 6.8 Identities = 9/32 (28%), Positives = 14/32 (43%) Query: 74 ISGKGQIVECSSAYLREIDKFEGCFPKQCKRF 105 +SG EC + + ++ GC PK F Sbjct: 32 VSGASTTDECQVTPVIHVLQYPGCVPKPIPSF 63 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.137 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,521 Number of Sequences: 317 Number of extensions: 3059 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 317 length of database: 114,650 effective HSP length: 57 effective length of query: 260 effective length of database: 96,581 effective search space: 25111060 effective search space used: 25111060 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 43 (21.4 bits)
- SilkBase 1999-2023 -