BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001475-TA|BGIBMGA001475-PA|IPR000504|RNA-binding region RNP-1 (RNA recognition motif), IPR006553|Leucine-rich repeat, cysteine-containing subtype, IPR001810|Cyclin-like F-box (577 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 28 0.15 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 28.3 bits (60), Expect = 0.15 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 4/65 (6%) Query: 263 VGDSLLALHIDHHWSALNDRTAHSIARFCPKLEELKLTDSSLVHLA----HVDSCIEKIT 318 +GDSLL L + H S+ + +LEEL L+++ L ++ H ++K+ Sbjct: 13 IGDSLLTLKLTHALSSSVQNFPSDAIKILNRLEELDLSNNRLRNVPDNSFHFLRSLKKVH 72 Query: 319 VANNT 323 + +NT Sbjct: 73 LQDNT 77 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.134 0.409 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,173 Number of Sequences: 317 Number of extensions: 4367 Number of successful extensions: 6 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 1 length of query: 577 length of database: 114,650 effective HSP length: 60 effective length of query: 517 effective length of database: 95,630 effective search space: 49440710 effective search space used: 49440710 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -