SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001475-TA|BGIBMGA001475-PA|IPR000504|RNA-binding region
RNP-1 (RNA recognition motif), IPR006553|Leucine-rich repeat,
cysteine-containing subtype, IPR001810|Cyclin-like F-box
         (577 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface pro...    28   0.15 

>AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface
           protein chaoptin protein.
          Length = 782

 Score = 28.3 bits (60), Expect = 0.15
 Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 263 VGDSLLALHIDHHWSALNDRTAHSIARFCPKLEELKLTDSSLVHLA----HVDSCIEKIT 318
           +GDSLL L + H  S+          +   +LEEL L+++ L ++     H    ++K+ 
Sbjct: 13  IGDSLLTLKLTHALSSSVQNFPSDAIKILNRLEELDLSNNRLRNVPDNSFHFLRSLKKVH 72

Query: 319 VANNT 323
           + +NT
Sbjct: 73  LQDNT 77


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.320    0.134    0.409 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 115,173
Number of Sequences: 317
Number of extensions: 4367
Number of successful extensions: 6
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 577
length of database: 114,650
effective HSP length: 60
effective length of query: 517
effective length of database: 95,630
effective search space: 49440710
effective search space used: 49440710
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 46 (22.6 bits)

- SilkBase 1999-2023 -