BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001474-TA|BGIBMGA001474-PA|IPR013025|Ribosomal protein L25/L23, IPR012678|Ribosomal L23 and L15e, core (150 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g29000.1 68414.m03546 heavy-metal-associated domain-containin... 31 0.33 At5g43660.1 68418.m05336 expressed protein similar to unknown pr... 30 0.57 At4g03350.1 68417.m00457 ubiquitin family protein contains INTER... 30 0.57 At4g37280.1 68417.m05276 MRG family protein contains Pfam domain... 30 0.76 At4g24930.1 68417.m03570 thylakoid lumenal 17.9 kDa protein, chl... 29 1.0 At2g34220.1 68415.m04187 hypothetical protein contains Pfam prof... 29 1.7 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 29 1.7 At1g10450.1 68414.m01176 paired amphipathic helix repeat-contain... 29 1.7 At5g63490.1 68418.m07970 CBS domain-containing protein / octicos... 28 3.1 At5g18730.1 68418.m02222 hypothetical protein predicted proteins... 28 3.1 At4g33330.1 68417.m04740 glycogenin glucosyltransferase (glycoge... 28 3.1 At3g05390.1 68416.m00589 expressed protein ; expression supporte... 27 5.3 At1g78210.1 68414.m09114 hydrolase, alpha/beta fold family prote... 27 5.3 At4g35920.3 68417.m05107 expressed protein contains Pfam profile... 27 7.1 At4g35920.2 68417.m05106 expressed protein contains Pfam profile... 27 7.1 At4g35920.1 68417.m05105 expressed protein contains Pfam profile... 27 7.1 At4g02970.1 68417.m00404 ubiquitin family protein contains INTER... 27 7.1 At3g11800.1 68416.m01446 expressed protein 27 7.1 At2g30840.1 68415.m03760 2-oxoglutarate-dependent dioxygenase, p... 27 7.1 At5g16730.1 68418.m01959 expressed protein weak similarity to mi... 26 9.3 At4g18330.2 68417.m02719 eukaryotic translation initiation facto... 26 9.3 At4g18330.1 68417.m02718 eukaryotic translation initiation facto... 26 9.3 At4g13780.1 68417.m02137 methionine--tRNA ligase, putative / met... 26 9.3 At3g62120.2 68416.m06980 tRNA synthetase class II (G, H, P and S... 26 9.3 At3g62120.1 68416.m06979 tRNA synthetase class II (G, H, P and S... 26 9.3 At3g26030.1 68416.m03242 serine/threonine protein phosphatase 2A... 26 9.3 >At1g29000.1 68414.m03546 heavy-metal-associated domain-containing protein similar to farnesylated protein ATFP3 [GI:4097547]; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 287 Score = 31.1 bits (67), Expect = 0.33 Identities = 31/108 (28%), Positives = 47/108 (43%), Gaps = 8/108 (7%) Query: 39 VHFHCSMEMTKYDIKNYLEKIYEVPVVDVRTKIN----MGKFKKDVVKGYVIKEDDVKVA 94 VH HC+ D+++ L K + +V TK G + + Y IK+ K A Sbjct: 119 VHIHCAQ--CDKDLQHKLLKHKAIHIVKTDTKAQTLTVQGTIESAKLLAY-IKKKVHKHA 175 Query: 95 FVTLPKTMTFKYPDLFEKSINEEEEHAKSLDESKK-NFRKYIDHNKSR 141 + KT K + +K EEE+ K DE KK +K + NK + Sbjct: 176 EIISSKTEEEKKKEEEDKKKKEEEDKKKKEDEKKKEEEKKKEEENKKK 223 >At5g43660.1 68418.m05336 expressed protein similar to unknown protein (gb|AAB72163.1) Length = 361 Score = 30.3 bits (65), Expect = 0.57 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 7/92 (7%) Query: 52 IKNYLEKIYEVPVVDVRTKINMGKFKKDVVKGYVIKEDDVKVAFVTLPKTMTFKY--PDL 109 + NY + E+ +D + + + F+K V + +E ++ F P FK PD Sbjct: 81 MSNYQPRFRELYKLDPESLL-LPCFRKAVREN--TEESFRRIMFEPFPGVYVFKMFQPDF 137 Query: 110 FEKSINEEEEHAKSLDESKKNFRKYIDHNKSR 141 F+K + E E K L E+K RK +NKS+ Sbjct: 138 FQKLLVEVENMRKWLHEAKLMIRK--PNNKSK 167 >At4g03350.1 68417.m00457 ubiquitin family protein contains INTERPRO:IPR000626 ubiquitin domain Length = 263 Score = 30.3 bits (65), Expect = 0.57 Identities = 15/60 (25%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query: 83 GYVIKEDDVKVAFVTLPKTMTFKY-PDLFEKSINEEEEHAKSLDESKKNFRKYIDHNKSR 141 G +++D K+ ++ L +++ + PD NE+ E +K +D+ K+ F D ++S+ Sbjct: 47 GKALEDDLHKIDYMILFESLLLRISPDADPNQSNEQTEQSKQIDDKKQEFCGIQDSSESK 106 >At4g37280.1 68417.m05276 MRG family protein contains Pfam domain PF05712: MRG Length = 320 Score = 29.9 bits (64), Expect = 0.76 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Query: 105 KYPDLFEKSINEEEEHAKSLDESKKNFRKYIDHNKSRPDIPS 146 K PDLF +N EEE + ++ +F K+I N+S +PS Sbjct: 263 KLPDLFSY-VNMEEETWSRMQQTLSDFLKFIQKNQSTFLLPS 303 >At4g24930.1 68417.m03570 thylakoid lumenal 17.9 kDa protein, chloroplast SP:Q9SW33;GI:17369630;PMID:11719511; similar to expressed protein gi:12321169 {Oryza sativa} Length = 225 Score = 29.5 bits (63), Expect = 1.0 Identities = 15/60 (25%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Query: 67 VRTKINMGKFKKDVVKGYVIKEDDVKVAFVTLPKTMTFKYPDLFEKSINEEEEHAKSLDE 126 V ++ G F +DV++ +++K+D V + T + + F S +EE K +D+ Sbjct: 155 VEAEVEGGGFSRDVME-FLVKQDVVAYRCMATKVTFVYPFTTAFGDSKGQEERLKKLIDQ 213 >At2g34220.1 68415.m04187 hypothetical protein contains Pfam profiles PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 718 Score = 28.7 bits (61), Expect = 1.7 Identities = 12/40 (30%), Positives = 23/40 (57%) Query: 86 IKEDDVKVAFVTLPKTMTFKYPDLFEKSINEEEEHAKSLD 125 + DDVK + +TL K++ K+P + K + + + K +D Sbjct: 627 VPNDDVKKSLLTLRKSLKEKFPLIDSKILQNKSTYEKLID 666 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 28.7 bits (61), Expect = 1.7 Identities = 26/73 (35%), Positives = 36/73 (49%), Gaps = 8/73 (10%) Query: 56 LEKIYEVPVVDVRTKINMGKFKKDVVKGYVIKEDDVKVAFVTLPKTMTFKYPDLFEKSIN 115 L+K P D+ TK+++ K KKDV+ V KE VK +PK + S + Sbjct: 20 LKKGKREPEDDIDTKVSLKKQKKDVIAA-VQKEKAVK----KVPKKVESSDD---SDSES 71 Query: 116 EEEEHAKSLDESK 128 EEEE AK + K Sbjct: 72 EEEEKAKKVPAKK 84 >At1g10450.1 68414.m01176 paired amphipathic helix repeat-containing protein similar to Sin3 protein [Yarrowia lipolytica] GI:18076824; contains Pfam profile PF02671: Paired amphipathic helix repeat Length = 1173 Score = 28.7 bits (61), Expect = 1.7 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 112 KSINEEEEHAKSLDESKKNFRKYIDHNKSRP 142 KS+N+EE H L+ +KK F +D ++ P Sbjct: 1074 KSVNDEENHGLFLNRNKKKFTS-LDESRGMP 1103 >At5g63490.1 68418.m07970 CBS domain-containing protein / octicosapeptide/Phox/Bemp1 (PB1) domain-containing protein contains Pfam profiles: PF00571 CBS domain, PF00564: PB1 domain Length = 543 Score = 27.9 bits (59), Expect = 3.1 Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 107 PDLFEKSINEEEEHAKSLDESKKNFRKYIDHNKS 140 PD F + + E+E+H K L S + + I+H KS Sbjct: 443 PDNFPQILYEDEDHDKVLLASDSDLQAAIEHAKS 476 >At5g18730.1 68418.m02222 hypothetical protein predicted proteins - Arabidopsis thaliana Length = 644 Score = 27.9 bits (59), Expect = 3.1 Identities = 19/77 (24%), Positives = 33/77 (42%), Gaps = 2/77 (2%) Query: 56 LEKIYEVPVVDVRTKINMGKFKKDVVKGYVIKEDDVKVAFVTLPKTMTFKYPDLFEKSIN 115 ++ + + PV D R + F+ Y EDD T+PKT ++ + + Sbjct: 561 VQLLTQQPVSDDRNDMEHRLFR--ACTEYTSNEDDGSEPIFTIPKTERIRFSNKVPATRV 618 Query: 116 EEEEHAKSLDESKKNFR 132 +E + + D SK FR Sbjct: 619 TKEMYGELEDNSKVEFR 635 >At4g33330.1 68417.m04740 glycogenin glucosyltransferase (glycogenin)-related similar to glycogenin glucosyltransferase (glycogenin-1) (EC 2.4.1.186) from Homo sapiens [SP|P46976], Mus musculus [SP|Q9R062], Oryctolagus cuniculus [GI:165513]; contains Pfam profile PF01501: Glycosyl transferase family 8 Length = 593 Score = 27.9 bits (59), Expect = 3.1 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 4/72 (5%) Query: 48 TKYDIKNYLEKIYEVPVVDVRTKINMGKFKKDVVKGYVIKEDDVKVAFVTLPKTMTFKYP 107 TK + +++E+I + +TKI M ++ + + + V + F + K FK+ Sbjct: 87 TKLEAPSFMEEILTRGLG--KTKIGMVNMEECDLTNWKRYGETVHIHFERVSKL--FKWQ 142 Query: 108 DLFEKSINEEEE 119 DLF + I+EEEE Sbjct: 143 DLFPEWIDEEEE 154 >At3g05390.1 68416.m00589 expressed protein ; expression supported by MPSS Length = 463 Score = 27.1 bits (57), Expect = 5.3 Identities = 12/38 (31%), Positives = 21/38 (55%) Query: 105 KYPDLFEKSINEEEEHAKSLDESKKNFRKYIDHNKSRP 142 K +L+EK ++ KS D SKK +K+++ +P Sbjct: 79 KMDNLYEKLEKTVKDMEKSKDGSKKEMKKFLEDEVMKP 116 >At1g78210.1 68414.m09114 hydrolase, alpha/beta fold family protein low similarity to hydrolases from Rhodococcus sp. EtbD2 GI:3273241, EtbD1 GI:3273239; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 314 Score = 27.1 bits (57), Expect = 5.3 Identities = 12/49 (24%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Query: 22 NFWMKLVRPHPKQLPNIVHFH---CSMEMTKYDIKNYLEKIYEVPVVDV 67 NFW+ +P K PN++ H + YD+ L + + + + D+ Sbjct: 38 NFWVSKTKPESKPKPNLLLIHGLGATAIWQWYDVARRLSRYFNLYIPDL 86 >At4g35920.3 68417.m05107 expressed protein contains Pfam profile PF04749: Protein of unknown function, DUF614; isoform contains AT-acceptor splice site at intron 8 Length = 421 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/53 (26%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Query: 81 VKGYVIKEDDVKVAFVTLPKTMTFKYPDL-FEKSINEEEEHAK-SLDESKKNF 131 V+ ++K++ + A L KT++ YP+L F +++ E E + L S++++ Sbjct: 159 VQDVILKQESTREAASVLKKTLSCSYPNLRFCEALKTENEKLQIELQRSQEHY 211 >At4g35920.2 68417.m05106 expressed protein contains Pfam profile PF04749: Protein of unknown function, DUF614; isoform contains AT-acceptor splice site at intron 8 Length = 421 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/53 (26%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Query: 81 VKGYVIKEDDVKVAFVTLPKTMTFKYPDL-FEKSINEEEEHAK-SLDESKKNF 131 V+ ++K++ + A L KT++ YP+L F +++ E E + L S++++ Sbjct: 159 VQDVILKQESTREAASVLKKTLSCSYPNLRFCEALKTENEKLQIELQRSQEHY 211 >At4g35920.1 68417.m05105 expressed protein contains Pfam profile PF04749: Protein of unknown function, DUF614; isoform contains AT-acceptor splice site at intron 8 Length = 421 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/53 (26%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Query: 81 VKGYVIKEDDVKVAFVTLPKTMTFKYPDL-FEKSINEEEEHAK-SLDESKKNF 131 V+ ++K++ + A L KT++ YP+L F +++ E E + L S++++ Sbjct: 159 VQDVILKQESTREAASVLKKTLSCSYPNLRFCEALKTENEKLQIELQRSQEHY 211 >At4g02970.1 68417.m00404 ubiquitin family protein contains INTERPRO:IPR000626 ubiquitin domain Length = 270 Score = 26.6 bits (56), Expect = 7.1 Identities = 15/61 (24%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Query: 83 GYVIKEDDVKVAFVTL--PKTMTFKYPDLFEKSINEEEEHAKSLDESKKNFRKYIDHNKS 140 G +++D K+ ++ L + + PD NE+ E +K +D+ K+ F D ++S Sbjct: 47 GKALEDDLHKIDYMILFESRLLLRISPDADPNQSNEQTEQSKQIDDKKQEFCGIQDSSES 106 Query: 141 R 141 + Sbjct: 107 K 107 >At3g11800.1 68416.m01446 expressed protein Length = 246 Score = 26.6 bits (56), Expect = 7.1 Identities = 15/60 (25%), Positives = 29/60 (48%), Gaps = 2/60 (3%) Query: 40 HFHCSMEMTKYDIKNYLEKIYEVPVVDVRTKINMGKFKKDVVKGYVIKEDDVKVAFVTLP 99 H H S+ ++ + K+ E+ ++ + T + F+ D KGY++ K A +LP Sbjct: 71 HRHLSLNGNS-EVAVFRPKVDEITLLTINTS-SSSSFRPDASKGYMVAFAGAKYAARSLP 128 >At2g30840.1 68415.m03760 2-oxoglutarate-dependent dioxygenase, putative similar to 2A6 (GI:599622) and tomato ethylene synthesis regulatory protein E8 (SP|P10967) Length = 362 Score = 26.6 bits (56), Expect = 7.1 Identities = 12/34 (35%), Positives = 19/34 (55%) Query: 78 KDVVKGYVIKEDDVKVAFVTLPKTMTFKYPDLFE 111 KD ++G+ ++ DV+ F T T T KY F+ Sbjct: 107 KDGIRGFHEQDSDVRKKFYTRDVTKTVKYNSNFD 140 >At5g16730.1 68418.m01959 expressed protein weak similarity to microtubule binding protein D-CLIP-190 [Drosophila melanogaster] GI:2773363, SMC2-like condensin [Arabidopsis thaliana] GI:14279543 Length = 853 Score = 26.2 bits (55), Expect = 9.3 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 4/54 (7%) Query: 87 KEDDVKVAFVTLPKTMTFK---YPDL-FEKSINEEEEHAKSLDESKKNFRKYID 136 K+D V+V F K +PD E EEEE + +DES K + ID Sbjct: 759 KDDSVEVIFKMWESCQIEKKEAFPDKKSELESQEEEEDSSKIDESDKTSTENID 812 >At4g18330.2 68417.m02719 eukaryotic translation initiation factor 2 subunit 3, putative / eIF2S3, putative / eIF-2-gamma, putative similar to SP|Q09130 Eukaryotic translation initiation factor 2 gamma subunit (eIF-2- gamma) {Schizosaccharomyces pombe}; contains Pfam profile PF00009: Elongation factor Tu GTP binding domain; isoform predicted to contain a TG non-consensus acceptor splice site. Length = 471 Score = 26.2 bits (55), Expect = 9.3 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Query: 61 EVPVVDVRTKINMGKFKKDVVKGYVIKEDDVKVA-FVTLPKTMTFKYPDL 109 + P+V V ++ K+ DVV Y++K+ + V FV+ PK + + D+ Sbjct: 217 DAPIVPVSAQL---KYNIDVVSEYIVKKIPIPVRDFVSPPKMIVIRSFDV 263 >At4g18330.1 68417.m02718 eukaryotic translation initiation factor 2 subunit 3, putative / eIF2S3, putative / eIF-2-gamma, putative similar to SP|Q09130 Eukaryotic translation initiation factor 2 gamma subunit (eIF-2- gamma) {Schizosaccharomyces pombe}; contains Pfam profile PF00009: Elongation factor Tu GTP binding domain; isoform predicted to contain a TG non-consensus acceptor splice site. Length = 284 Score = 26.2 bits (55), Expect = 9.3 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Query: 61 EVPVVDVRTKINMGKFKKDVVKGYVIKEDDVKVA-FVTLPKTMTFKYPDL 109 + P+V V ++ K+ DVV Y++K+ + V FV+ PK + + D+ Sbjct: 217 DAPIVPVSAQL---KYNIDVVSEYIVKKIPIPVRDFVSPPKMIVIRSFDV 263 >At4g13780.1 68417.m02137 methionine--tRNA ligase, putative / methionyl-tRNA synthetase, putative / MetRS, putative similar to methionyl-tRNA synthetase [Oryza sativa] GI:4091008; contains Pfam profiles PF00133: tRNA synthetases class I (I, L, M and V), PF01588: Putative tRNA binding domain Length = 797 Score = 26.2 bits (55), Expect = 9.3 Identities = 12/30 (40%), Positives = 19/30 (63%) Query: 51 DIKNYLEKIYEVPVVDVRTKINMGKFKKDV 80 D+ N +K++E +VD+ TK N+ KDV Sbjct: 748 DVLNPKKKVWETLLVDLNTKENLVACYKDV 777 >At3g62120.2 68416.m06980 tRNA synthetase class II (G, H, P and S) family protein similar to SP|P07814 Bifunctional aminoacyl-tRNA synthetase [Includes: Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA ligase); Prolyl-tRNA synthetase (EC 6.1.1.15) (Proline--tRNA ligase)] {Homo sapiens}; contains Pfam profiles PF00587: tRNA synthetase class II core domain (G, H, P, S and T), PF03129: Anticodon binding domain Length = 530 Score = 26.2 bits (55), Expect = 9.3 Identities = 18/81 (22%), Positives = 34/81 (41%) Query: 27 LVRPHPKQLPNIVHFHCSMEMTKYDIKNYLEKIYEVPVVDVRTKINMGKFKKDVVKGYVI 86 ++RP + I+ E+ K +KN ++ P V + K ++ F +V Sbjct: 81 ILRPWSMAIWEIMQIFFDAEIKKMKVKNCYFPLFVSPGVLEKEKDHIEGFAPEVAWVTKS 140 Query: 87 KEDDVKVAFVTLPKTMTFKYP 107 + D++V P + T YP Sbjct: 141 GKSDLEVPIAIRPTSETVMYP 161 >At3g62120.1 68416.m06979 tRNA synthetase class II (G, H, P and S) family protein similar to SP|P07814 Bifunctional aminoacyl-tRNA synthetase [Includes: Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA ligase); Prolyl-tRNA synthetase (EC 6.1.1.15) (Proline--tRNA ligase)] {Homo sapiens}; contains Pfam profiles PF00587: tRNA synthetase class II core domain (G, H, P, S and T), PF03129: Anticodon binding domain Length = 530 Score = 26.2 bits (55), Expect = 9.3 Identities = 18/81 (22%), Positives = 34/81 (41%) Query: 27 LVRPHPKQLPNIVHFHCSMEMTKYDIKNYLEKIYEVPVVDVRTKINMGKFKKDVVKGYVI 86 ++RP + I+ E+ K +KN ++ P V + K ++ F +V Sbjct: 81 ILRPWSMAIWEIMQIFFDAEIKKMKVKNCYFPLFVSPGVLEKEKDHIEGFAPEVAWVTKS 140 Query: 87 KEDDVKVAFVTLPKTMTFKYP 107 + D++V P + T YP Sbjct: 141 GKSDLEVPIAIRPTSETVMYP 161 >At3g26030.1 68416.m03242 serine/threonine protein phosphatase 2A (PP2A) regulatory subunit B', putative similar to SWISS-PROT:Q28653 serine/threonine protein phosphatase 2A, 56 kDa regulatory subunit, delta isoform (PP2A, B subunit, B' delta isoform, PP2A, B subunit, B56 delta isoform, PP2A, B subunit, PR61 delta isoform, PP2A, B subunit, R5 delta isoform, PP2A, B subunit, B'-gamma) [Oryctolagus cuniculus]; contains Pfam domain, PF01603: Protein phosphatase 2A regulatory B subunit (B56 family) Length = 477 Score = 26.2 bits (55), Expect = 9.3 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 100 KTMTFKYPDLFEKSINE-EEEHAKSLDESKKN 130 K ++ PDLFE+ +++ +E+ K+ D KKN Sbjct: 430 KVLSDTNPDLFEECLHKFQEDQQKAEDTKKKN 461 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.321 0.138 0.426 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,012,275 Number of Sequences: 28952 Number of extensions: 171467 Number of successful extensions: 494 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 15 Number of HSP's that attempted gapping in prelim test: 483 Number of HSP's gapped (non-prelim): 26 length of query: 150 length of database: 12,070,560 effective HSP length: 75 effective length of query: 75 effective length of database: 9,899,160 effective search space: 742437000 effective search space used: 742437000 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 55 (26.2 bits)
- SilkBase 1999-2023 -