BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001474-TA|BGIBMGA001474-PA|IPR013025|Ribosomal protein L25/L23, IPR012678|Ribosomal L23 and L15e, core (150 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 27 0.069 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 1.5 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 1.5 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 1.5 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 1.5 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 1.5 AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax pr... 23 1.5 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 1.5 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 2.0 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 20 7.9 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 27.1 bits (57), Expect = 0.069 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Query: 97 TLPKTMTFKYPDLFEKSINEEEEHAKSLDESK-KNFRKYIDHNKSRPDI 144 TL T+T Y +K +E E + K LDE K + I+ N +PDI Sbjct: 392 TLIATVTVNYYRHKQKRRDERERYFKGLDEEKLPESGENIEINLIKPDI 440 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 1.5 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 15 QLRVFLPNFWMKLVRPHPKQLPNIVHFHCS 44 Q++++ N MK + H NIV +H S Sbjct: 263 QIKIWFQNRRMKWKKEHKMASMNIVPYHMS 292 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 1.5 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 15 QLRVFLPNFWMKLVRPHPKQLPNIVHFHCS 44 Q++++ N MK + H NIV +H S Sbjct: 263 QIKIWFQNRRMKWKKEHKMASMNIVPYHMS 292 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 1.5 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 15 QLRVFLPNFWMKLVRPHPKQLPNIVHFHCS 44 Q++++ N MK + H NIV +H S Sbjct: 263 QIKIWFQNRRMKWKKEHKMASMNIVPYHMS 292 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 1.5 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 15 QLRVFLPNFWMKLVRPHPKQLPNIVHFHCS 44 Q++++ N MK + H NIV +H S Sbjct: 219 QIKIWFQNRRMKWKKEHKMASMNIVPYHMS 248 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 1.5 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 15 QLRVFLPNFWMKLVRPHPKQLPNIVHFHCS 44 Q++++ N MK + H NIV +H S Sbjct: 263 QIKIWFQNRRMKWKKEHKMASMNIVPYHMS 292 >AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax protein. Length = 100 Score = 22.6 bits (46), Expect = 1.5 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 15 QLRVFLPNFWMKLVRPHPKQLPNIVHFHCS 44 Q++++ N MK + H NIV +H S Sbjct: 51 QIKIWFQNRRMKWKKEHKMASMNIVPYHMS 80 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 1.5 Identities = 10/30 (33%), Positives = 16/30 (53%) Query: 15 QLRVFLPNFWMKLVRPHPKQLPNIVHFHCS 44 Q++++ N MK + H NIV +H S Sbjct: 263 QIKIWFQNRRMKWKKEHKMASMNIVPYHMS 292 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 22.2 bits (45), Expect = 2.0 Identities = 27/99 (27%), Positives = 39/99 (39%), Gaps = 12/99 (12%) Query: 44 SMEMTKYDIKNYLEKIYEVPVVDVRTKINMGKFKK--DVVKGYVIKEDDVKVAFVTLPKT 101 S E +Y Y + Y V+ K +G F + DVV G ++E V L + Sbjct: 406 SPESRQYTAFLYNGRSYTYQVLPFGLKTAVGSFSRAMDVVLGTEVREFVVNYIDDLLVAS 465 Query: 102 MTFKYPDLFEKSINEEEEHAKSLDESKKNFRKYIDHNKS 140 T +NE EH + + E K R I+ KS Sbjct: 466 ET----------LNEHLEHLRQVFEKLKQARMTINLEKS 494 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 20.2 bits (40), Expect = 7.9 Identities = 8/22 (36%), Positives = 12/22 (54%) Query: 33 KQLPNIVHFHCSMEMTKYDIKN 54 ++ PNI H CS + T + N Sbjct: 9 RESPNIDHNSCSSDDTVLSVGN 30 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.138 0.426 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 40,096 Number of Sequences: 317 Number of extensions: 1689 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 150 length of database: 114,650 effective HSP length: 52 effective length of query: 98 effective length of database: 98,166 effective search space: 9620268 effective search space used: 9620268 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.4 bits) S2: 40 (20.2 bits)
- SilkBase 1999-2023 -