SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA001471-TA|BGIBMGA001471-PA|IPR005713|Ribosomal protein
S15, eukaryotic and archaeal form, IPR002222|Ribosomal protein S19/S15
         (147 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.       23   1.1  

>X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.
          Length = 524

 Score = 23.0 bits (47), Expect = 1.1
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 4/35 (11%)

Query: 69  APPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKT 103
           A PN KP+  + HLR +    EM     G+++ KT
Sbjct: 134 ASPNRKPDDNQDHLRRL----EMSLEKSGLFSSKT 164


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.320    0.139    0.400 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,382
Number of Sequences: 317
Number of extensions: 1214
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 147
length of database: 114,650
effective HSP length: 51
effective length of query: 96
effective length of database: 98,483
effective search space:  9454368
effective search space used:  9454368
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.3 bits)
S2: 40 (20.2 bits)

- SilkBase 1999-2023 -