BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001469-TA|BGIBMGA001469-PA|IPR005055|Insect pheromone-binding protein A10/OS-D (106 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44732| Best HMM Match : TSP_1 (HMM E-Value=0) 28 1.8 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 >SB_44732| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 675 Score = 27.9 bits (59), Expect = 1.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Query: 24 VTDTALDEALNDKRFIQRQLKCALGEAPCDPIG 56 VT + D+ N K QRQ KC LG P +G Sbjct: 539 VTCSTRDDRCNAKSMPQRQRKCNLGACPVWRVG 571 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 27.5 bits (58), Expect = 2.3 Identities = 18/65 (27%), Positives = 25/65 (38%), Gaps = 4/65 (6%) Query: 22 PQVTDTALDEALNDKRFIQRQLKCALGEAPCDPIGKRLKTLAPLVLRGACPQCSPQETKQ 81 P V +D+A D ++ + +GEAP P AP P +P K Sbjct: 278 PPVPTLPVDKAKMDSEYLSLMAELGVGEAPPPPAASEPAAFAP----APPPSQAPPPPKT 333 Query: 82 IQKTL 86 I TL Sbjct: 334 IPSTL 338 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.321 0.133 0.412 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,997,532 Number of Sequences: 59808 Number of extensions: 103002 Number of successful extensions: 197 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 194 Number of HSP's gapped (non-prelim): 3 length of query: 106 length of database: 16,821,457 effective HSP length: 72 effective length of query: 34 effective length of database: 12,515,281 effective search space: 425519554 effective search space used: 425519554 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -