BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001468-TA|BGIBMGA001468-PA|IPR001965|Zinc finger, PHD-type, IPR011011|Zinc finger, FYVE/PHD-type (487 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g14740.2 68416.m01864 PHD finger family protein similar to zi... 36 0.046 At3g14740.1 68416.m01863 PHD finger family protein similar to zi... 36 0.046 At5g01480.1 68418.m00061 DC1 domain-containing protein contains ... 36 0.060 At1g55380.1 68414.m06334 DC1 domain-containing protein contains ... 36 0.080 At3g61740.1 68416.m06923 PHD finger family protein (ATX3) contai... 35 0.14 At5g53430.1 68418.m06640 PHD finger family protein / SET domain-... 34 0.18 At1g33710.1 68414.m04168 expressed protein ; expression supporte... 34 0.18 At1g05830.1 68414.m00610 trithorax protein, putative / PHD finge... 34 0.18 At3g52100.1 68416.m05717 PHD finger family protein contains Pfam... 34 0.24 At1g55700.1 68414.m06378 DC1 domain-containing protein contains ... 34 0.24 At2g31650.1 68415.m03864 trithorax 1 (ATX-1) (TRX1) identical to... 33 0.32 At3g08020.1 68416.m00979 PHD finger protein-related contains low... 33 0.43 At1g26150.1 68414.m03192 protein kinase family protein similar t... 33 0.43 At4g22140.1 68417.m03200 PHD finger family protein / bromo-adjac... 32 0.74 At5g42280.1 68418.m05146 DC1 domain-containing protein contains ... 32 0.98 At1g55420.1 68414.m06339 DC1 domain-containing protein contains ... 32 0.98 At1g55390.1 68414.m06335 DC1 domain-containing protein similar t... 32 0.98 At1g34480.1 68414.m04285 DC1 domain-containing protein contains ... 32 0.98 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 31 1.3 At3g05220.2 68416.m00570 heavy-metal-associated domain-containin... 31 1.3 At3g05220.1 68416.m00569 heavy-metal-associated domain-containin... 31 1.3 At1g55440.1 68414.m06341 DC1 domain-containing protein contains ... 31 1.3 At5g59930.1 68418.m07515 DC1 domain-containing protein / UV-B li... 31 1.7 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 31 1.7 At5g55780.1 68418.m06952 DC1 domain-containing protein contains ... 31 2.3 At5g12400.1 68418.m01458 PHD finger transcription factor, putati... 31 2.3 At5g05610.2 68418.m00611 PHD finger family protein contains Pfam... 31 2.3 At5g05610.1 68418.m00610 PHD finger family protein contains Pfam... 31 2.3 At2g23990.2 68415.m02866 plastocyanin-like domain-containing pro... 31 2.3 At2g23990.1 68415.m02865 plastocyanin-like domain-containing pro... 31 2.3 At1g79480.1 68414.m09263 hypothetical protein low similarity to ... 31 2.3 At1g44050.1 68414.m05082 DC1 domain-containing protein contains ... 31 2.3 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 31 2.3 At5g02330.1 68418.m00156 DC1 domain-containing protein contains ... 30 3.0 At3g46800.1 68416.m05080 DC1 domain-containing protein contains ... 30 3.0 At3g24010.1 68416.m03016 PHD finger family protein contains Pfam... 30 3.0 At2g47700.1 68415.m05957 zinc finger (C3HC4-type RING finger) fa... 30 3.0 At5g26210.1 68418.m03119 PHD finger family protein contains Pfam... 30 4.0 At2g28460.1 68415.m03457 DC1 domain-containing protein contains ... 30 4.0 At2g23100.1 68415.m02756 DC1 domain-containing protein contains ... 30 4.0 At1g55430.1 68414.m06340 DC1 domain-containing protein contains ... 30 4.0 At5g58610.1 68418.m07345 PHD finger transcription factor, putative 29 5.2 At5g26190.1 68418.m03116 DC1 domain-containing protein contains ... 29 5.2 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 29 5.2 At5g05910.1 68418.m00653 zinc finger (C3HC4-type RING finger) fa... 29 5.2 At3g49260.2 68416.m05384 calmodulin-binding family protein low s... 29 5.2 At3g49260.1 68416.m05383 calmodulin-binding family protein low s... 29 5.2 At5g60410.2 68418.m07579 DNA-binding family protein contains Pfa... 29 6.9 At5g60410.1 68418.m07578 DNA-binding family protein contains Pfa... 29 6.9 At5g43810.1 68418.m05357 pinhead protein (PINHEAD) / zwille prot... 29 6.9 At4g30860.1 68417.m04381 SET domain-containing protein low simil... 29 6.9 At5g43040.1 68418.m05254 DC1 domain-containing protein contains ... 29 9.2 At5g13210.1 68418.m01516 expressed protein 29 9.2 At5g07190.1 68418.m00819 embryo-specific protein 3, putative sim... 29 9.2 At5g02350.1 68418.m00158 DC1 domain-containing protein contains ... 29 9.2 At3g28650.1 68416.m03576 DC1 domain-containing protein similar ... 29 9.2 At2g13900.1 68415.m01542 DC1 domain-containing protein contains ... 29 9.2 At2g02620.1 68415.m00201 DC1 domain-containing protein / PHD fin... 29 9.2 >At3g14740.2 68416.m01864 PHD finger family protein similar to zinc-finger protein BR140 [PIR|JC2069][Homo sapiens]; contains PHD-finger domain PF00628 Length = 343 Score = 36.3 bits (80), Expect = 0.046 Identities = 21/58 (36%), Positives = 26/58 (44%), Gaps = 5/58 (8%) Query: 422 CGVCHKEVHDNDQAILCESGCNFWFHRGCTGLSEPAFQLLTAEVYAEWVCDKCLSSKN 479 C VC D I+ GC+ H C G P L+ A +W C +CLSSKN Sbjct: 153 CAVCQSTDGDPLNPIVFCDGCDLMVHASCYG--NP---LVKAIPEGDWFCRQCLSSKN 205 >At3g14740.1 68416.m01863 PHD finger family protein similar to zinc-finger protein BR140 [PIR|JC2069][Homo sapiens]; contains PHD-finger domain PF00628 Length = 341 Score = 36.3 bits (80), Expect = 0.046 Identities = 21/58 (36%), Positives = 26/58 (44%), Gaps = 5/58 (8%) Query: 422 CGVCHKEVHDNDQAILCESGCNFWFHRGCTGLSEPAFQLLTAEVYAEWVCDKCLSSKN 479 C VC D I+ GC+ H C G P L+ A +W C +CLSSKN Sbjct: 153 CAVCQSTDGDPLNPIVFCDGCDLMVHASCYG--NP---LVKAIPEGDWFCRQCLSSKN 205 >At5g01480.1 68418.m00061 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 413 Score = 35.9 bits (79), Expect = 0.060 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Query: 399 KVYPPDQPMVFNPQNP-NAPPIYPCGVCHKEVHDNDQAILC-ESGCNFWFHRGCTGLSE 455 KV + + F P P P + CGVCH ++++N C + GC + H C S+ Sbjct: 226 KVSRHNHRLTFTPNLPYEEPTVTDCGVCHAKINENYGEYSCTKKGCVYAVHSRCAMQSD 284 >At1g55380.1 68414.m06334 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 661 Score = 35.5 bits (78), Expect = 0.080 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 3/50 (6%) Query: 403 PDQP-MVFNPQNPNAPPIYPCGVCH-KEVHDNDQAILCESGCNFWFHRGC 450 P QP M+ + P+ PP+ C C K++ N+ C + CN FHRGC Sbjct: 20 PAQPHMLCRRRRPSHPPLSICFSCKGKQLKRNNYYYYCAT-CNLEFHRGC 68 Score = 28.7 bits (61), Expect = 9.2 Identities = 11/34 (32%), Positives = 16/34 (47%) Query: 417 PPIYPCGVCHKEVHDNDQAILCESGCNFWFHRGC 450 P + CGVC + V N C+ C++ H C Sbjct: 273 PGDFSCGVCRQTVDVNYGQYSCDKECHYAVHSKC 306 >At3g61740.1 68416.m06923 PHD finger family protein (ATX3) contains Pfam domains PF00628: PHD-finger and PF00855: PWWP domain; identical to cDNA trithorax 3 (ATX3) partial cds GI:15217142 Length = 799 Score = 34.7 bits (76), Expect = 0.14 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Query: 422 CGVCHKEVHDNDQAI-LCESGCNFWFHRGCTGLSEPAFQLLTAEVY 466 CG+C + H +D +C GC+ W H C ++ F+ L Y Sbjct: 351 CGICKRIWHPSDDGDWVCCDGCDVWVHAECDNITNERFKELEHNNY 396 >At5g53430.1 68418.m06640 PHD finger family protein / SET domain-containing protein (TX5) contains Pfam domain, PF00628: PHD-finger and PF00856: SET domain; identical to cDNA trithorax 5 (TX5) partial cds GI:16118406 Length = 1043 Score = 34.3 bits (75), Expect = 0.18 Identities = 19/78 (24%), Positives = 33/78 (42%), Gaps = 6/78 (7%) Query: 399 KVYPPDQPMVFNPQNPNAPPIYPCGVCHKEVH--DNDQAILCESGCNFWFHRGCTGLSEP 456 K P ++ P + P + CG+C + + D+ + C+ GC W H C +S Sbjct: 393 KALIPGDQLLCQPCSKLTKPKHVCGICKRIWNHLDSQSWVRCD-GCKVWIHSACDQISHK 451 Query: 457 AFQLLTAEVYAEWVCDKC 474 F+ L ++ C C Sbjct: 452 HFKDLGE---TDYYCPTC 466 >At1g33710.1 68414.m04168 expressed protein ; expression supported by MPSS Length = 210 Score = 34.3 bits (75), Expect = 0.18 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Query: 422 CGVCHKEVHDNDQAIL-CESGCNFWFHRGCTGLSEPAFQLLTAEVYAEWVCDK 473 CG+C ++ D D L CE C W H L PAF + +W + Sbjct: 90 CGLCSLDIEDRDHLFLTCEFACFLW-HTVSVRLELPAFSFVVWNDLMDWTLQR 141 >At1g05830.1 68414.m00610 trithorax protein, putative / PHD finger family protein / SET domain-containing protein similar to trithorax-like protein 1 [Arabidopsis thaliana] GI:12659210; contains Pfam domain, PF00628: PHD-finger and PF00856: SET domain Length = 1056 Score = 34.3 bits (75), Expect = 0.18 Identities = 23/80 (28%), Positives = 34/80 (42%), Gaps = 11/80 (13%) Query: 396 SAGKVYPPDQPMVFNPQNPNAPPIYPCGVCH-KEVHDNDQAILCESGCNFWFHRGCTGLS 454 S+GK D P + P + C VCH E ++N+ + C+ C H C G Sbjct: 570 SSGKYQ--DHPTGYRPVRVEWKDLDKCNVCHMDEEYENNLFLQCDK-CRMMVHTRCYGQL 626 Query: 455 EPAFQLLTAEVYAEWVCDKC 474 EP +L W+C+ C Sbjct: 627 EPHNGIL-------WLCNLC 639 >At3g52100.1 68416.m05717 PHD finger family protein contains Pfam profile PF00628: PHD-finger Length = 696 Score = 33.9 bits (74), Expect = 0.24 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 422 CGVCHKEVHDNDQA-ILCESGCNFWFHRGCTGLSEPAFQLLTAEVYAEWVCDKC 474 C VC K D++ ++C C W H C G+S+ + + ++ C C Sbjct: 299 CPVCLKVYRDSEATPMVCCDFCQRWVHCQCDGISDEKYMQFQVDGNLQYKCSTC 352 >At1g55700.1 68414.m06378 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 679 Score = 33.9 bits (74), Expect = 0.24 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Query: 413 NPNAPP-IYPCGVCHKEVHDNDQAILCESGCNFWFHRGC 450 +P+ P IYPCGVC + C GC++ H C Sbjct: 300 SPSLPSGIYPCGVCRLTIDVTYGQFSCNRGCHYAVHSKC 338 >At2g31650.1 68415.m03864 trithorax 1 (ATX-1) (TRX1) identical to trithorax-like protein 1 GI:12659210 from [Arabidopsis thaliana]; characterized in Alvarez-Venegas R,et al, ATX-1, an Arabidopsis Homolog of Trithorax, Activates Flower Homeotic Genes.(Curr Biol. 2003 Apr 15;13(8):627-37 PMID: 12699618); contains Pfam profiles PF00856: SET domain, PF00855: PWWP domain, PF00628, PHD-finger; identical to cDNA trithorax-like protein 1 (TRX1) GI:12659209 Length = 1062 Score = 33.5 bits (73), Expect = 0.32 Identities = 20/72 (27%), Positives = 31/72 (43%), Gaps = 9/72 (12%) Query: 404 DQPMVFNPQNPNAPPIYPCGVCH-KEVHDNDQAILCESGCNFWFHRGCTGLSEPAFQLLT 462 +QP + P + + C VCH E ++N+ + C+ C H C G EP L Sbjct: 594 NQPTGYRPVRVDWKDLDKCNVCHMDEEYENNLFLQCDK-CRMMVHAKCYGELEPCDGAL- 651 Query: 463 AEVYAEWVCDKC 474 W+C+ C Sbjct: 652 ------WLCNLC 657 >At3g08020.1 68416.m00979 PHD finger protein-related contains low similarity to PHD-finger domain proteins Length = 764 Score = 33.1 bits (72), Expect = 0.43 Identities = 14/54 (25%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 422 CGVCHKEVHDNDQA-ILCESGCNFWFHRGCTGLSEPAFQLLTAEVYAEWVCDKC 474 C VC K D++ ++C C W H C G+S+ + + ++ C C Sbjct: 286 CPVCLKVYRDSESTPMVCCDICQRWVHCHCDGISDDKYMQFQVDGKLQYKCATC 339 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 33.1 bits (72), Expect = 0.43 Identities = 17/42 (40%), Positives = 20/42 (47%) Query: 9 PSYRLPGPGLGPPDFKPPMDTPTPQASAPSNPKKRRKTSNAS 50 PS LP P L PP PP P+P AS P + + AS Sbjct: 163 PSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPPRHLPSPPAS 204 Score = 28.7 bits (61), Expect = 9.2 Identities = 12/37 (32%), Positives = 16/37 (43%) Query: 9 PSYRLPGPGLGPPDFKPPMDTPTPQASAPSNPKKRRK 45 P LP P PP D+ P P +PK+R + Sbjct: 194 PPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQ 230 >At4g22140.1 68417.m03200 PHD finger family protein / bromo-adjacent homology (BAH) domain-containing protein contains Pfam domain, PF00628: PHD-finger and PF01426: BAH domain Length = 196 Score = 32.3 bits (70), Expect = 0.74 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 6/56 (10%) Query: 425 CHKEVHDNDQAILCESGCNFWFHRGCTGLSEPAFQLLTAEVYAEWVCDKCLSSKNI 480 C + +D + CE GC W+H C G++ + A+ +VC +C S ++ Sbjct: 113 CEMPYNPDDLMVQCE-GCKDWYHPACVGMT-----IEEAKKLDHFVCAECSSDDDV 162 >At5g42280.1 68418.m05146 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 694 Score = 31.9 bits (69), Expect = 0.98 Identities = 12/39 (30%), Positives = 18/39 (46%) Query: 417 PPIYPCGVCHKEVHDNDQAILCESGCNFWFHRGCTGLSE 455 P + CGVC + + N+ C GC++ H C E Sbjct: 319 PGDFLCGVCRQTIDVNNGQYSCNKGCHYAVHSKCATRKE 357 >At1g55420.1 68414.m06339 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 725 Score = 31.9 bits (69), Expect = 0.98 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Query: 403 PDQP-MVFNPQNPNAPPIYPCGVCH-KEVHDNDQAILCESGCNFWFHRGC 450 P QP + + P+ PP+ C C K++ + C + CN FHRGC Sbjct: 20 PAQPHKLCRRRRPSYPPLSICFTCKGKQLRSSAYYYYCAT-CNLEFHRGC 68 >At1g55390.1 68414.m06335 DC1 domain-containing protein similar to hypothetical protein GI:4204272 from [Arabidopsis thaliana] contains weak PHD zinc finger motifs contains weak PHD zinc finger motifs DC1 domain, a divergent protein kinase C domain of unknown function. Length = 684 Score = 31.9 bits (69), Expect = 0.98 Identities = 12/31 (38%), Positives = 15/31 (48%) Query: 420 YPCGVCHKEVHDNDQAILCESGCNFWFHRGC 450 + CGVC + V N C GCN+ H C Sbjct: 318 FSCGVCRQTVDINYGHYSCNKGCNYAVHSKC 348 >At1g34480.1 68414.m04285 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 602 Score = 31.9 bits (69), Expect = 0.98 Identities = 12/29 (41%), Positives = 15/29 (51%) Query: 422 CGVCHKEVHDNDQAILCESGCNFWFHRGC 450 CGVC K+V +N C GC + H C Sbjct: 249 CGVCRKKVDENYGGYSCVKGCYYVSHSRC 277 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 31.5 bits (68), Expect = 1.3 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Query: 2 SHNLAGMPSYRLPGPGLGPPDFKPPMDTPTPQASAPSNPK 41 S + AG+P +LP PG P PP P PQ P PK Sbjct: 247 SSSAAGLPPLKLP-PGRSAPP-PPPAAAPPPQPPPPPPPK 284 >At3g05220.2 68416.m00570 heavy-metal-associated domain-containing protein similar to farnesylated protein 1 (GI:23304411) {Hordeum vulgare subsp. spontaneum}; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 478 Score = 31.5 bits (68), Expect = 1.3 Identities = 18/37 (48%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Query: 262 GPMGPSCSNGSMGPNNSIMSSNPMQNSVMGPGHCGPM 298 GPMGP G GP + PM S+MGPG GPM Sbjct: 331 GPMGPGGPMGQGGPMGMMGPGGPM--SMMGPG--GPM 363 >At3g05220.1 68416.m00569 heavy-metal-associated domain-containing protein similar to farnesylated protein 1 (GI:23304411) {Hordeum vulgare subsp. spontaneum}; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 577 Score = 31.5 bits (68), Expect = 1.3 Identities = 18/37 (48%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Query: 262 GPMGPSCSNGSMGPNNSIMSSNPMQNSVMGPGHCGPM 298 GPMGP G GP + PM S+MGPG GPM Sbjct: 430 GPMGPGGPMGQGGPMGMMGPGGPM--SMMGPG--GPM 462 >At1g55440.1 68414.m06341 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 653 Score = 31.5 bits (68), Expect = 1.3 Identities = 13/34 (38%), Positives = 16/34 (47%) Query: 417 PPIYPCGVCHKEVHDNDQAILCESGCNFWFHRGC 450 P + CGVC K V N C GC++ H C Sbjct: 265 PGDFSCGVCRKTVDVNYGQYSCIKGCHYAVHSHC 298 >At5g59930.1 68418.m07515 DC1 domain-containing protein / UV-B light-insensitive protein, putative similar to ULI3 (UV-B light insensitive) [Arabidopsis thaliana] GI:17225050; contains Pfam profile PF03107: DC1 domain Length = 656 Score = 31.1 bits (67), Expect = 1.7 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 6/52 (11%) Query: 404 DQPMVFNPQNPNAPPIYPCGVCHKEVHDNDQAILCESGCNFWFHRGCTGLSE 455 D P+VF + P C VC + + + L GC +FH GC LS+ Sbjct: 124 DHPLVFLKKRQEKTP---CEVCKNRILGSSYSCL---GCELYFHVGCIHLSK 169 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/37 (37%), Positives = 18/37 (48%) Query: 9 PSYRLPGPGLGPPDFKPPMDTPTPQASAPSNPKKRRK 45 P ++ P P PP PP+ PTP S P P +K Sbjct: 457 PVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQK 493 Score = 29.5 bits (63), Expect = 5.2 Identities = 13/32 (40%), Positives = 15/32 (46%) Query: 9 PSYRLPGPGLGPPDFKPPMDTPTPQASAPSNP 40 P + P P PP PP+ PTP S P P Sbjct: 507 PIQKPPTPTYSPPIKPPPVKPPTPTYSPPIKP 538 Score = 28.7 bits (61), Expect = 9.2 Identities = 13/32 (40%), Positives = 15/32 (46%) Query: 9 PSYRLPGPGLGPPDFKPPMDTPTPQASAPSNP 40 P + P P PP PP+ PTP S P P Sbjct: 323 PVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKP 354 >At5g55780.1 68418.m06952 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 685 Score = 30.7 bits (66), Expect = 2.3 Identities = 12/35 (34%), Positives = 20/35 (57%) Query: 417 PPIYPCGVCHKEVHDNDQAILCESGCNFWFHRGCT 451 P + CGVC ++V +N A CE +++ H C+ Sbjct: 295 PGNFSCGVCRQQVDNNYGAYSCEICDDYFVHSKCS 329 >At5g12400.1 68418.m01458 PHD finger transcription factor, putative similarity to predicted proteins, Arabidopsis thaliana Length = 1595 Score = 30.7 bits (66), Expect = 2.3 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 6/52 (11%) Query: 433 DQAILCESGCNFWFHRGCTGLSEPAFQLLTAEVYAEWVCDKCLSSKNIPLVK 484 D ++LC GC +H C GL A LL +W C +C + P +K Sbjct: 617 DGSLLCCDGCPAAYHSKCVGL---ASHLLPE---GDWYCPECAFDRRAPGLK 662 >At5g05610.2 68418.m00611 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 241 Score = 30.7 bits (66), Expect = 2.3 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 6/57 (10%) Query: 422 CGVCHKEVHDNDQAILCESGCNFWFHRGCTGLSEPAFQLLTAEVYAEWVCDKCLSSK 478 CG C + ND+ +C C W+H C ++ PA AE ++ C C + K Sbjct: 188 CGSCGGN-YTNDEFWICCDVCERWYHGKCVKIT-PA----KAESIKQYKCPSCCTKK 238 >At5g05610.1 68418.m00610 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 241 Score = 30.7 bits (66), Expect = 2.3 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 6/57 (10%) Query: 422 CGVCHKEVHDNDQAILCESGCNFWFHRGCTGLSEPAFQLLTAEVYAEWVCDKCLSSK 478 CG C + ND+ +C C W+H C ++ PA AE ++ C C + K Sbjct: 188 CGSCGGN-YTNDEFWICCDVCERWYHGKCVKIT-PA----KAESIKQYKCPSCCTKK 238 >At2g23990.2 68415.m02866 plastocyanin-like domain-containing protein Length = 226 Score = 30.7 bits (66), Expect = 2.3 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Query: 9 PSYRLPGPGLGPPDFKPPMDTPTPQASAPSNPKKRRKTSNAS 50 P++ PGP P PP + TP A AP+ P K+S ++ Sbjct: 150 PNHPKPGPAAVTPTL-PPKPSTTPAAPAPAPPTPSPKSSTST 190 >At2g23990.1 68415.m02865 plastocyanin-like domain-containing protein Length = 207 Score = 30.7 bits (66), Expect = 2.3 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Query: 9 PSYRLPGPGLGPPDFKPPMDTPTPQASAPSNPKKRRKTSNAS 50 P++ PGP P PP + TP A AP+ P K+S ++ Sbjct: 131 PNHPKPGPAAVTPTL-PPKPSTTPAAPAPAPPTPSPKSSTST 171 >At1g79480.1 68414.m09263 hypothetical protein low similarity to beta-1,3-glucanase-like protein GI:9758115 from [Arabidopsis thaliana] Length = 356 Score = 30.7 bits (66), Expect = 2.3 Identities = 13/26 (50%), Positives = 16/26 (61%) Query: 14 PGPGLGPPDFKPPMDTPTPQASAPSN 39 PGP LGPP +P TPT +PS+ Sbjct: 216 PGPVLGPPYSEPGPSTPTGSIPSPSS 241 >At1g44050.1 68414.m05082 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 530 Score = 30.7 bits (66), Expect = 2.3 Identities = 11/29 (37%), Positives = 17/29 (58%) Query: 422 CGVCHKEVHDNDQAILCESGCNFWFHRGC 450 CGVCH++V +N A C + ++ H C Sbjct: 160 CGVCHQQVDNNYGAYSCNNCDGYFVHSKC 188 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 30.7 bits (66), Expect = 2.3 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 14 PGPGLGPPDFKPPMDTPTPQAS-APSNPKKRRKT 46 P P GPP P TP P APS PK KT Sbjct: 111 PVPPHGPPPKPAPAPTPAPSPKPAPSPPKPENKT 144 >At5g02330.1 68418.m00156 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 656 Score = 30.3 bits (65), Expect = 3.0 Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 420 YPCGVCHKEVHDNDQAILCESGCNFWFHRGC 450 + CGVC K+V +N A C +++ H C Sbjct: 306 WSCGVCRKKVDNNCGAYTCNKCSHYFVHTRC 336 >At3g46800.1 68416.m05080 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 682 Score = 30.3 bits (65), Expect = 3.0 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Query: 422 CGVCHKEVHDNDQAILCESG-CNFWFHRGCTGLSEPAFQ 459 C +C+ + N++ LCE CN FH C GL +Q Sbjct: 152 CNMCNTNIKINEKQ-LCECRLCNILFHLDCVGLIPNVYQ 189 >At3g24010.1 68416.m03016 PHD finger family protein contains Pfam profile: PF00628 PHD-finger Length = 234 Score = 30.3 bits (65), Expect = 3.0 Identities = 19/69 (27%), Positives = 27/69 (39%), Gaps = 13/69 (18%) Query: 411 PQNPNAPPIYPCGVCHKEVHDNDQAILCESGCNF-WFHRGCTGLSEPAFQLLTAEVYAEW 469 P +PN P C +V + + C WFH GC GL E + +W Sbjct: 172 PVDPNEPTYCICN----QVSFGEMVACDNNACKIEWFHFGCVGLKE--------QPKGKW 219 Query: 470 VCDKCLSSK 478 C +C + K Sbjct: 220 YCPECATVK 228 >At2g47700.1 68415.m05957 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type(RING finger) Length = 358 Score = 30.3 bits (65), Expect = 3.0 Identities = 12/43 (27%), Positives = 20/43 (46%) Query: 410 NPQNPNAPPIYPCGVCHKEVHDNDQAILCESGCNFWFHRGCTG 452 NP++ ++P C +C + V D+ + C FH C G Sbjct: 26 NPEDSSSPVEVSCSICLESVLDDGTRSKAKLQCGHQFHLDCIG 68 >At5g26210.1 68418.m03119 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 255 Score = 29.9 bits (64), Expect = 4.0 Identities = 17/57 (29%), Positives = 26/57 (45%), Gaps = 6/57 (10%) Query: 422 CGVCHKEVHDNDQAILCESGCNFWFHRGCTGLSEPAFQLLTAEVYAEWVCDKCLSSK 478 CG C E + D+ +C C WFH C ++ PA AE ++ C C + + Sbjct: 202 CGACG-ESYAADEFWICCDLCEMWFHGKCVKIT-PA----RAEHIKQYKCPSCSNKR 252 >At2g28460.1 68415.m03457 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 704 Score = 29.9 bits (64), Expect = 4.0 Identities = 9/31 (29%), Positives = 17/31 (54%) Query: 420 YPCGVCHKEVHDNDQAILCESGCNFWFHRGC 450 + C VC K++ ++ +C GC++ H C Sbjct: 337 WSCSVCRKKIDNDYGGYVCTKGCSYAAHSKC 367 >At2g23100.1 68415.m02756 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 711 Score = 29.9 bits (64), Expect = 4.0 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Query: 414 PNAPPIYPCGVCHKEVHDNDQAILCESGCNFWFHRGCTGL 453 P P+ PC VC ++D + CN+ HR C L Sbjct: 273 PRRIPL-PCDVCGLSLNDAHDPVYACLPCNYMVHRACINL 311 >At1g55430.1 68414.m06340 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 657 Score = 29.9 bits (64), Expect = 4.0 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 3/50 (6%) Query: 403 PDQP-MVFNPQNPNAPPIYPCGVCH-KEVHDNDQAILCESGCNFWFHRGC 450 P QP + + P PP+ C C K + + C + CN FHRGC Sbjct: 26 PAQPHKLCRRRQPTHPPLSICFTCKGKHLKRSKYYYYCAT-CNLEFHRGC 74 Score = 29.9 bits (64), Expect = 4.0 Identities = 11/34 (32%), Positives = 15/34 (44%) Query: 417 PPIYPCGVCHKEVHDNDQAILCESGCNFWFHRGC 450 P + CG+C V N C+ GC + H C Sbjct: 289 PGDFSCGLCRHTVDVNCGQYSCDKGCQYAIHSKC 322 >At5g58610.1 68418.m07345 PHD finger transcription factor, putative Length = 1065 Score = 29.5 bits (63), Expect = 5.2 Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 8/57 (14%) Query: 399 KVYPPDQPMVFNPQNPNAPPIYPCGVCHKEVHDNDQAILCESGCNFWFHRGCTGLSE 455 K PPD + Q N ++ C VCH + ILC+ GC FH C GL + Sbjct: 677 KAQPPDMLKMKLRQGEN--DVF-CSVCHY----GGKLILCD-GCPSAFHANCLGLED 725 >At5g26190.1 68418.m03116 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 556 Score = 29.5 bits (63), Expect = 5.2 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 417 PPIYPCGVCHKEVHDNDQAILCESGCNFWFHRGC 450 P + CGVCHK +++ A C S C++ H C Sbjct: 192 PEEWICGVCHKIINNQYGAYSC-SVCHYAVHSKC 224 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 29.5 bits (63), Expect = 5.2 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Query: 9 PSYRLPGPGLGPPDFKPP-MDTPTPQASAPSNPKKRRKTS 47 P+Y+ P P + PP +PP PTP P+ + T+ Sbjct: 105 PTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKPPTT 144 >At5g05910.1 68418.m00653 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 151 Score = 29.5 bits (63), Expect = 5.2 Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 4/33 (12%) Query: 422 CGVCHKEV----HDNDQAILCESGCNFWFHRGC 450 C +C +++ +D+D+ ++C S CN FH C Sbjct: 92 CPICLEDLKKVDNDDDKVVVCLSKCNHSFHMNC 124 >At3g49260.2 68416.m05384 calmodulin-binding family protein low similarity to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 471 Score = 29.5 bits (63), Expect = 5.2 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Query: 1 MSHNLAGMP-SYRLPGPGLGPPDFKPPMDTPTPQASA 36 + H ++ P + R GPG GP + PP P P A+A Sbjct: 288 LDHWMSSQPYTGRQTGPGPGPGQYNPPPYPPFPTAAA 324 >At3g49260.1 68416.m05383 calmodulin-binding family protein low similarity to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 471 Score = 29.5 bits (63), Expect = 5.2 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Query: 1 MSHNLAGMP-SYRLPGPGLGPPDFKPPMDTPTPQASA 36 + H ++ P + R GPG GP + PP P P A+A Sbjct: 288 LDHWMSSQPYTGRQTGPGPGPGQYNPPPYPPFPTAAA 324 >At5g60410.2 68418.m07579 DNA-binding family protein contains Pfam profiles: PF02037 SAP domain, PF02891 MIZ zinc finger, PF00628 PHD-finger Length = 885 Score = 29.1 bits (62), Expect = 6.9 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Query: 411 PQNPNAPPIYPCGVCHKEVHDNDQAILCESG-CNFWFHRGCTGLSE 455 P++P P I VC + + D I CE C+ W H GC L + Sbjct: 103 PEDPFQPEIKVRCVCGNSL-ETDSMIQCEDPRCHVWQHVGCVILPD 147 >At5g60410.1 68418.m07578 DNA-binding family protein contains Pfam profiles: PF02037 SAP domain, PF02891 MIZ zinc finger, PF00628 PHD-finger Length = 873 Score = 29.1 bits (62), Expect = 6.9 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Query: 411 PQNPNAPPIYPCGVCHKEVHDNDQAILCESG-CNFWFHRGCTGLSE 455 P++P P I VC + + D I CE C+ W H GC L + Sbjct: 103 PEDPFQPEIKVRCVCGNSL-ETDSMIQCEDPRCHVWQHVGCVILPD 147 >At5g43810.1 68418.m05357 pinhead protein (PINHEAD) / zwille protein (ZWILLE) identical to SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 988 Score = 29.1 bits (62), Expect = 6.9 Identities = 14/42 (33%), Positives = 19/42 (45%) Query: 3 HNLAGMPSYRLPGPGLGPPDFKPPMDTPTPQASAPSNPKKRR 44 HN + + ++P P P P QAS+PS P K R Sbjct: 24 HNPKTVQNGKIPPPSPSPVTVTTPATVTQSQASSPSPPSKNR 65 >At4g30860.1 68417.m04381 SET domain-containing protein low similarity to IL-5 promoter REII-region-binding protein [Homo sapiens] GI:12642795; contains Pfam profile PF00856: SET domain Length = 497 Score = 29.1 bits (62), Expect = 6.9 Identities = 20/76 (26%), Positives = 28/76 (36%), Gaps = 10/76 (13%) Query: 409 FNPQNPNAPPIYPCGVCHKEVHDNDQAILCESGCNFWFHRGCT----GLSE------PAF 458 F P A + C VCHK V+ + GC +H C G S+ P Sbjct: 108 FLPFLVGAKKMVDCLVCHKPVYPGEDLSCSVRGCQGAYHSLCAKESLGFSKSSKFKCPQH 167 Query: 459 QLLTAEVYAEWVCDKC 474 + + +W C KC Sbjct: 168 ECFVCKQRTQWRCVKC 183 >At5g43040.1 68418.m05254 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 551 Score = 28.7 bits (61), Expect = 9.2 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 420 YPCGVCHKEVHDNDQAILCESGCNFWFHRGC 450 + CGVC KEV+ A C + C F H C Sbjct: 191 WSCGVCRKEVNGMHGAFSCLT-CTFAVHSRC 220 >At5g13210.1 68418.m01516 expressed protein Length = 673 Score = 28.7 bits (61), Expect = 9.2 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Query: 14 PGPGLGPPDFKPPMD-TPTP-QASAPSNPKKRRKTSNASN 51 P P LGPP+ + P P P S PS+P SN +N Sbjct: 3 PSPLLGPPELRDPNSLLPKPTTTSGPSDPFMDAMVSNFNN 42 >At5g07190.1 68418.m00819 embryo-specific protein 3, putative similar to embryo-specific protein 3 GI:3335171 from [Arabidopsis thaliana] Length = 213 Score = 28.7 bits (61), Expect = 9.2 Identities = 17/50 (34%), Positives = 20/50 (40%), Gaps = 6/50 (12%) Query: 4 NLAGMPSYRLPGPGLGPPDFKP--PMDTPTPQASAPSNPKKRRKTSNASN 51 N G PS P L PP F P P +TPT P P + N + Sbjct: 149 NTTGRPS----SPDLPPPHFPPEFPPETPTTPPPPPPRPSAASRLGNGES 194 >At5g02350.1 68418.m00158 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 651 Score = 28.7 bits (61), Expect = 9.2 Identities = 10/31 (32%), Positives = 18/31 (58%) Query: 420 YPCGVCHKEVHDNDQAILCESGCNFWFHRGC 450 + CGVC ++V++N A C +++ H C Sbjct: 306 WSCGVCRQKVNNNCGAYTCNKCRHYFVHTRC 336 >At3g28650.1 68416.m03576 DC1 domain-containing protein similar to hypothetical protein GI:4204272 from [Arabidopsis thaliana] contains weak PHD zinc finger motifs contains weak PHD zinc finger motifs DC1 domain, a divergent protein kinase C domain of unknown function. Length = 665 Score = 28.7 bits (61), Expect = 9.2 Identities = 13/37 (35%), Positives = 19/37 (51%) Query: 414 PNAPPIYPCGVCHKEVHDNDQAILCESGCNFWFHRGC 450 P P + CGVC +E++ + A C S N+ H C Sbjct: 300 PLGPGDWICGVCWEEINWSYGAYSCSSCPNYAIHSRC 336 >At2g13900.1 68415.m01542 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 661 Score = 28.7 bits (61), Expect = 9.2 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Query: 420 YPCGVCHKEVHDNDQAILCESGCNFWF-HRGC 450 + CGVC ++V +N A C CN +F H C Sbjct: 308 WSCGVCRQKVDNNCGAYTCNK-CNHYFVHTRC 338 >At2g02620.1 68415.m00201 DC1 domain-containing protein / PHD finger protein-related contains Pfam profiles PF03107: DC1 domain, weak hit to PF00628: PHD-finger Length = 513 Score = 28.7 bits (61), Expect = 9.2 Identities = 11/32 (34%), Positives = 16/32 (50%) Query: 419 IYPCGVCHKEVHDNDQAILCESGCNFWFHRGC 450 I+ CGVC KE+ + A +C + H C Sbjct: 165 IWSCGVCRKEIDGDYGAYICNICSGYAVHTRC 196 Database: arabidopsis Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.315 0.134 0.442 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,891,395 Number of Sequences: 28952 Number of extensions: 228788 Number of successful extensions: 1452 Number of sequences better than 10.0: 58 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 34 Number of HSP's that attempted gapping in prelim test: 1319 Number of HSP's gapped (non-prelim): 162 length of query: 487 length of database: 12,070,560 effective HSP length: 84 effective length of query: 403 effective length of database: 9,638,592 effective search space: 3884352576 effective search space used: 3884352576 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -