BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001465-TA|BGIBMGA001465-PA|undefined (181 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 >SB_8470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3133 Score = 27.9 bits (59), Expect = 5.2 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 6/80 (7%) Query: 24 HSIKTRHNPTAHKKLLLNFNG--IPLVNVISELQLVFNDVN---CQKCTDCMERAVKAF- 77 H +KTR TA+ +LL ++ G + ++ +S++Q DV + D + K F Sbjct: 778 HDLKTRPGETAYVRLLKDWRGSDVDILQEVSKVQSSVQDVGQHVAKGFKDVGQNVAKGFK 837 Query: 78 IINQHIISSRPNLEDFQNDV 97 + Q + S ++D +V Sbjct: 838 DVGQQVQSVDKKVQDIDQNV 857 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.319 0.135 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,784,296 Number of Sequences: 59808 Number of extensions: 202833 Number of successful extensions: 429 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 428 Number of HSP's gapped (non-prelim): 2 length of query: 181 length of database: 16,821,457 effective HSP length: 78 effective length of query: 103 effective length of database: 12,156,433 effective search space: 1252112599 effective search space used: 1252112599 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -