BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001465-TA|BGIBMGA001465-PA|undefined (181 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY024361-1|AAK00583.1| 4911|Homo sapiens MLL3 protein. 35 0.19 AL833924-1|CAD38780.1| 1033|Homo sapiens hypothetical protein pr... 35 0.19 AK022687-1|BAB14179.1| 452|Homo sapiens protein ( Homo sapiens ... 35 0.19 >AY024361-1|AAK00583.1| 4911|Homo sapiens MLL3 protein. Length = 4911 Score = 34.7 bits (76), Expect = 0.19 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Query: 49 NVISELQLVFNDVNCQKCTDCMERAVKAFIINQHIISSRPNLEDFQNDVLYEKLNINRNK 108 N + EL L N C + M VK F++ H ++S + FQ+ V E LN +K Sbjct: 4694 NPLMELPLAVNPTGCARSEPKMSAHVKRFVLRPHTLNSTSTSKSFQSTVTGE-LNAPYSK 4752 Query: 109 RDANKK 114 + + K Sbjct: 4753 QFVHSK 4758 >AL833924-1|CAD38780.1| 1033|Homo sapiens hypothetical protein protein. Length = 1033 Score = 34.7 bits (76), Expect = 0.19 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Query: 49 NVISELQLVFNDVNCQKCTDCMERAVKAFIINQHIISSRPNLEDFQNDVLYEKLNINRNK 108 N + EL L N C + M VK F++ H ++S + FQ+ V E LN +K Sbjct: 816 NPLMELPLAVNPTGCARSEPKMSAHVKRFVLRPHTLNSTSTSKSFQSTVTGE-LNAPYSK 874 Query: 109 RDANKK 114 + + K Sbjct: 875 QFVHSK 880 >AK022687-1|BAB14179.1| 452|Homo sapiens protein ( Homo sapiens cDNA FLJ12625 fis, clone NT2RM4001783, weakly similar to ZINC FINGER PROTEIN HRX. ). Length = 452 Score = 34.7 bits (76), Expect = 0.19 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Query: 49 NVISELQLVFNDVNCQKCTDCMERAVKAFIINQHIISSRPNLEDFQNDVLYEKLNINRNK 108 N + EL L N C + M VK F++ H ++S + FQ+ V E LN +K Sbjct: 235 NPLMELPLAVNPTGCARSEPKMSAHVKRFVLRPHTLNSTSTSKSFQSTVTGE-LNAPYSK 293 Query: 109 RDANKK 114 + + K Sbjct: 294 QFVHSK 299 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.319 0.135 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,779,313 Number of Sequences: 224733 Number of extensions: 832444 Number of successful extensions: 2452 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2449 Number of HSP's gapped (non-prelim): 3 length of query: 181 length of database: 73,234,838 effective HSP length: 85 effective length of query: 96 effective length of database: 54,132,533 effective search space: 5196723168 effective search space used: 5196723168 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 62 (29.1 bits)
- SilkBase 1999-2023 -