BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001464-TA|BGIBMGA001464-PA|IPR001708|60 kDa inner membrane insertion protein (396 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 23 5.0 DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory pro... 23 5.0 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 22.6 bits (46), Expect = 5.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 113 TLDVPWWGAIVLGTIVVRVVMFPLVIL 139 TL +W A+ TI+ + PL+IL Sbjct: 227 TLANTFWSALYFLTIIFLFFIIPLIIL 253 >DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory protein 8 protein. Length = 99 Score = 22.6 bits (46), Expect = 5.0 Identities = 12/33 (36%), Positives = 15/33 (45%) Query: 146 QMNNNLPEIQLLQMKMTQARQTGNQIEAARYAQ 178 Q+ LPEI + +RQ N ARY Q Sbjct: 51 QIKGALPEIIGKNCERCDSRQVANARRIARYVQ 83 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.323 0.137 0.414 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,017 Number of Sequences: 317 Number of extensions: 3139 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 2 length of query: 396 length of database: 114,650 effective HSP length: 58 effective length of query: 338 effective length of database: 96,264 effective search space: 32537232 effective search space used: 32537232 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -