BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001464-TA|BGIBMGA001464-PA|IPR001708|60 kDa inner membrane insertion protein (396 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 25 3.6 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 25.0 bits (52), Expect = 3.6 Identities = 24/102 (23%), Positives = 44/102 (43%), Gaps = 5/102 (4%) Query: 206 ISFFMGLRGMANCPVESMTHGGLWWFVDLTVPDQYFLLPVITSATMWATIE-LGVDGGRL 264 IS+ +C V++ ++ +F VP L P++ S + L DG L Sbjct: 642 ISWLSSYLSNRSCRVKTGSYLSEEFFCTSGVPQGCVLSPLLFSLFINDVCNVLPPDGHLL 701 Query: 265 DAQNMQVMRYVLRAIPLVMIPFTINFPGAILVYWCSSNFISL 306 A ++++ V + + + +N V+WCSSN + L Sbjct: 702 YADDIKIFLPVSSSSDCMSLQHYLN----AFVHWCSSNLLRL 739 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.323 0.137 0.414 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 354,984 Number of Sequences: 2123 Number of extensions: 13260 Number of successful extensions: 23 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 23 Number of HSP's gapped (non-prelim): 1 length of query: 396 length of database: 516,269 effective HSP length: 65 effective length of query: 331 effective length of database: 378,274 effective search space: 125208694 effective search space used: 125208694 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 49 (23.8 bits)
- SilkBase 1999-2023 -