BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001462-TA|BGIBMGA001462-PA|IPR001251|Cellular retinaldehyde-binding/triple function, C-terminal, IPR011074|Phosphatidylinositol transfer protein-like, N-terminal (280 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_07_0045 + 12328388-12328419,12328504-12328645,12328862-123290... 30 1.8 06_03_1376 - 29687417-29687536,29687622-29687688,29688448-296885... 30 1.8 02_05_0770 - 31623415-31623960,31624467-31624709,31624808-316249... 30 2.4 01_03_0047 + 11939747-11939857,11940058-11940121,11940123-119402... 30 2.4 03_05_0960 + 29221087-29221091,29221370-29221468,29221773-292218... 29 3.2 07_01_0434 - 3302926-3303072,3303402-3303545,3303644-3304293,330... 29 4.2 10_08_0959 - 21813756-21814097,21814462-21814570,21814688-218147... 29 5.5 12_01_0812 - 7460448-7460507,7460595-7460672,7460772-7460981,746... 28 7.3 06_03_0492 - 21386587-21386700,21387471-21387599,21387715-213877... 28 7.3 03_06_0307 + 33027012-33027167,33028505-33028615,33028927-330290... 28 7.3 03_02_0844 + 11695159-11695263,11695402-11695463,11695789-116958... 28 7.3 06_03_0763 - 24405525-24405701,24406209-24406368,24406924-244070... 28 9.6 02_05_0818 + 32004749-32005347,32005905-32006415,32006539-32007300 28 9.6 >10_07_0045 + 12328388-12328419,12328504-12328645,12328862-12329054, 12329224-12329320,12329404-12329528,12329616-12329734, 12331225-12331298,12331359-12331413,12331450-12331500, 12331611-12331857,12331940-12332036,12332170-12332244, 12334286-12334488,12334757-12334905,12334995-12335168, 12335276-12335401,12335493-12335623,12335743-12335818, 12335898-12336027,12336115-12336193,12336267-12336465, 12336591-12336698,12336769-12337025,12337267-12337282 Length = 984 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/39 (33%), Positives = 22/39 (56%) Query: 16 LAKEDYLPQDLGDMLLKKFIHSCYGSLEKTKQCIDKFCV 54 L K++ L D +M ++KF++ + KTKQ I C+ Sbjct: 815 LKKDEPLESDCFNMAIRKFMYEKIEMIHKTKQAISNHCL 853 >06_03_1376 - 29687417-29687536,29687622-29687688,29688448-29688504, 29689365-29689435,29690326-29690385,29690470-29690601, 29690828-29690986 Length = 221 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query: 2 QIDYERDISLIREWLAKEDYLPQDLGDMLLKKFIHSCYGSLEKTKQCIDKFCVG 55 ++D + IR+ LAK++ +L L K+ IHS LE K + K+C+G Sbjct: 152 RLDLNLERGRIRDELAKQNEETTELTTKLDKE-IHSLKAQLEAAKYDVIKYCIG 204 >02_05_0770 - 31623415-31623960,31624467-31624709,31624808-31624906, 31625058-31625234,31625441-31625512 Length = 378 Score = 29.9 bits (64), Expect = 2.4 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 3/79 (3%) Query: 124 NIPLFPRGHIVLIDAKHFYLKIVSRVNIFFFKQFLVYLLEAMPVRIKQIHVYNSPAYYDK 183 N+P + LID F L S +++ K L P R+ +YN+P +++ Sbjct: 138 NLPHDQSQMVWLIDFAGFSL---SNISLHVTKLTADVLQGHYPERLGVAILYNAPKFFES 194 Query: 184 LFSLVKPVLPQEICDMIKF 202 + + P+L + + +KF Sbjct: 195 FWKIASPILEPKTFNKVKF 213 >01_03_0047 + 11939747-11939857,11940058-11940121,11940123-11940253, 11940325-11940432,11942735-11942783,11943188-11943279, 11944394-11944468,11944553-11944658,11944740-11944786, 11944856-11944913,11945299-11945348,11945728-11945784, 11945909-11945916,11946020-11946055,11946904-11946937, 11947030-11947092,11947223-11947237 Length = 367 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/39 (33%), Positives = 23/39 (58%) Query: 16 LAKEDYLPQDLGDMLLKKFIHSCYGSLEKTKQCIDKFCV 54 + K+ L +D +M ++KF++ SL KT + I K C+ Sbjct: 59 ILKDGPLDRDCFNMAIRKFMYENIQSLHKTSEAITKHCL 97 >03_05_0960 + 29221087-29221091,29221370-29221468,29221773-29221815, 29222056-29222154,29222240-29222485,29222633-29222941 Length = 266 Score = 29.5 bits (63), Expect = 3.2 Identities = 23/98 (23%), Positives = 49/98 (50%), Gaps = 8/98 (8%) Query: 166 PVRIKQIHVYNSPAYYDKLFSLVKPVLPQEICDMIKF-HLEIEG----LYAHVDKKYLPV 220 P R+ ++N P ++ + +VK L + + F +L+ E L+ ++D + LPV Sbjct: 144 PERLAIGILFNPPKVFEAFWKVVKHFLDPKSIQKVNFVYLKNEESMKILHKYIDPEVLPV 203 Query: 221 ELGGEAPSMKDQQKKWVKIITESRDMYLNDNLWKADMK 258 E GG+ ++ +++ K++ +D + W +D K Sbjct: 204 EFGGK-NNVVYSHEEYSKLMV--KDDIKMASFWASDTK 238 >07_01_0434 - 3302926-3303072,3303402-3303545,3303644-3304293, 3304410-3304493,3304651-3304703,3305127-3305197, 3305285-3305362,3305775-3305903,3305988-3306044, 3306693-3306923,3307748-3307882,3308609-3308684, 3308768-3309024,3309095-3309202,3309328-3309526, 3309600-3309604 Length = 807 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/39 (30%), Positives = 22/39 (56%) Query: 16 LAKEDYLPQDLGDMLLKKFIHSCYGSLEKTKQCIDKFCV 54 L K++ L D +M ++KF++ + KTK+ I C+ Sbjct: 25 LKKDEPLESDCFNMAIRKFMYEKIEMIHKTKEAISNHCL 63 >10_08_0959 - 21813756-21814097,21814462-21814570,21814688-21814740, 21814849-21815049,21815320-21815433,21815513-21815671, 21816490-21816849,21816928-21817149,21817967-21818093, 21818887-21819023,21819169-21819292,21819665-21820174, 21820255-21820436,21820812-21820862,21821114-21821266, 21821339-21821437,21821519-21821861,21821957-21822030, 21822105-21823025,21823133-21823257,21823419-21823461, 21823574-21823762,21824814-21825074,21825228-21825387, 21826200-21826363,21826523-21827009,21827090-21827431, 21827519-21827836,21828001-21828041,21828136-21828388, 21829158-21829261,21830198-21830386,21830543-21831196, 21831320-21831610,21831739-21831882,21832107-21832205, 21832549-21832657,21832739-21832923,21833008-21833121, 21833270-21833401,21833483-21833815,21833945-21834436, 21834773-21834847,21834917-21835066,21835143-21835241, 21835463-21835547,21837188-21837375,21837513-21837647, 21837729-21837849,21838127-21838194,21838275-21838370, 21838450-21838554,21838665-21838980,21839053-21839142, 21840011-21840181,21840850-21841010,21841088-21841270, 21841839-21841940,21842515-21842632,21842704-21842798, 21842972-21843022,21843107-21843241,21843333-21843436, 21844249-21844414,21844649-21844773,21845220-21845316 Length = 4181 Score = 28.7 bits (61), Expect = 5.5 Identities = 17/73 (23%), Positives = 33/73 (45%) Query: 117 QADYWLNNIPLFPRGHIVLIDAKHFYLKIVSRVNIFFFKQFLVYLLEAMPVRIKQIHVYN 176 + D +LN + L+D + + + + VN+ + +Y M VR+ + + Sbjct: 778 EQDMYLNFNLVLSDVSAFLVDGDYHWNERSNEVNLLIQLESALYPSTRMAVRVPSLGFHF 837 Query: 177 SPAYYDKLFSLVK 189 SPA Y +L + K Sbjct: 838 SPARYHRLMEIFK 850 >12_01_0812 - 7460448-7460507,7460595-7460672,7460772-7460981, 7461095-7461142,7461270-7461455,7461653-7461656, 7461766-7461893 Length = 237 Score = 28.3 bits (60), Expect = 7.3 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 3/66 (4%) Query: 135 LIDAKHFYLKIVSRVNIFFFKQFLVYLLEAMPVRIKQIHVYNSPAYYDKLFSLVKPVLPQ 194 L+D + KIV FFF Y+L V ++Q+ N ++ D+++S +K + + Sbjct: 61 LVDRWRNHKKIVISETRFFFYLDRYYILRKSLVPLEQL---NLCSFRDQVYSELKDKITR 117 Query: 195 EICDMI 200 + DMI Sbjct: 118 TVVDMI 123 >06_03_0492 - 21386587-21386700,21387471-21387599,21387715-21387790, 21387898-21387950,21388034-21388095,21388164-21388274, 21388361-21388527,21388804-21388869,21389416-21389505, 21389592-21389740,21390182-21390316,21390399-21390454, 21390630-21390663,21391908-21392018 Length = 450 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Query: 7 RDISLIREWLAKEDYLPQDLGDMLLKKFIHSCYGSLEKTKQCIDKFCVG 55 R +S WLA EDY P LG L +H+ L+ + +D F G Sbjct: 288 RRVSFRTMWLASEDY-PLLLGSADLGVSLHTSSSGLDLPMKVVDMFGCG 335 >03_06_0307 + 33027012-33027167,33028505-33028615,33028927-33029065, 33029215-33029323,33029422-33029425 Length = 172 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/30 (36%), Positives = 19/30 (63%) Query: 214 DKKYLPVELGGEAPSMKDQQKKWVKIITES 243 ++KY+ + GG P M +++ KW K I E+ Sbjct: 94 NEKYVSLFSGGNTPDMLEKRNKWRKQIKEN 123 >03_02_0844 + 11695159-11695263,11695402-11695463,11695789-11695876, 11695958-11696019,11696250-11696346,11696592-11696984, 11697072-11697611,11697856-11697966,11698102-11698242, 11698290-11698394,11698480-11698557,11699346-11699472, 11699580-11699625,11699709-11699754 Length = 666 Score = 28.3 bits (60), Expect = 7.3 Identities = 14/43 (32%), Positives = 25/43 (58%) Query: 56 RTNTPELYTSRDPTASKLKTAFSITSVTTYEAGEDEILIHELD 98 +++ P YTS D + S+ +AF SV+T +A D L+ ++ Sbjct: 433 QSDVPCKYTSSDASNSQAWSAFEAKSVSTQQASPDLSLMSSIE 475 >06_03_0763 - 24405525-24405701,24406209-24406368,24406924-24407005, 24407098-24407167,24407443-24407607,24407731-24407874, 24408467-24408715,24409006-24409221,24409306-24409398 Length = 451 Score = 27.9 bits (59), Expect = 9.6 Identities = 28/79 (35%), Positives = 40/79 (50%), Gaps = 11/79 (13%) Query: 16 LAKE--DYLPQDLGDMLLKKFIH-SCYGSLEKTKQCIDKFCVGRTNTP------ELYTSR 66 LA+E YL DLG +L+K+F Y L+++ + D F V T +P EL+ Sbjct: 101 LAQEIASYLGVDLGKVLIKRFADGEIYVQLQESVRGCDVFLVQPTCSPVNENLMELFVMI 160 Query: 67 DPTASKLKTAFSITSVTTY 85 D A + +A SIT V Y Sbjct: 161 D--ACRRASARSITVVIPY 177 >02_05_0818 + 32004749-32005347,32005905-32006415,32006539-32007300 Length = 623 Score = 27.9 bits (59), Expect = 9.6 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Query: 192 LPQEICDMIKFHLEIEGLYAHVDKKYLPVELGG---EAPS 228 +P + +++K HL+ EG VDK YL L G +APS Sbjct: 579 MPDLVVEVMKDHLDDEGEMETVDKLYLYRSLAGARNDAPS 618 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.322 0.138 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,087,359 Number of Sequences: 37544 Number of extensions: 336885 Number of successful extensions: 670 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 6 Number of HSP's that attempted gapping in prelim test: 662 Number of HSP's gapped (non-prelim): 14 length of query: 280 length of database: 14,793,348 effective HSP length: 81 effective length of query: 199 effective length of database: 11,752,284 effective search space: 2338704516 effective search space used: 2338704516 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -