BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001462-TA|BGIBMGA001462-PA|IPR001251|Cellular retinaldehyde-binding/triple function, C-terminal, IPR011074|Phosphatidylinositol transfer protein-like, N-terminal (280 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 27 0.79 AY187041-1|AAO39755.1| 272|Anopheles gambiae putative antennal ... 24 4.2 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 26.6 bits (56), Expect = 0.79 Identities = 10/36 (27%), Positives = 17/36 (47%) Query: 25 DLGDMLLKKFIHSCYGSLEKTKQCIDKFCVGRTNTP 60 D+ + + + C+GS + + C CV T TP Sbjct: 103 DIVKNVTRVVVQGCWGSNDDQESCSSNECVSTTETP 138 >AY187041-1|AAO39755.1| 272|Anopheles gambiae putative antennal carrier protein TOL-1 protein. Length = 272 Score = 24.2 bits (50), Expect = 4.2 Identities = 9/18 (50%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Query: 237 VKIITESRDMYLNDNLWK 254 VK++ +S + YLNDN W+ Sbjct: 212 VKVLEDSTNQYLNDN-WR 228 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.322 0.138 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 296,109 Number of Sequences: 2123 Number of extensions: 12530 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 2 length of query: 280 length of database: 516,269 effective HSP length: 63 effective length of query: 217 effective length of database: 382,520 effective search space: 83006840 effective search space used: 83006840 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -