BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001460-TA|BGIBMGA001460-PA|IPR002112|Transcription factor Jun, IPR004827|Basic-leucine zipper (bZIP) transcription factor, IPR008917|Eukaryotic transcription factor, DNA-binding, IPR011616|bZIP transcription factor, bZIP_1 (356 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 23 3.4 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 23 3.4 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 23 3.4 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 22 7.8 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 7.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 7.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 7.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 7.8 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 22 7.8 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 42 ANLLSQSKLNDLKESRNEYE 61 A L + KLNDL++ R YE Sbjct: 67 AETLKRYKLNDLEKRREVYE 86 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 42 ANLLSQSKLNDLKESRNEYE 61 A L + KLNDL++ R YE Sbjct: 227 AETLKRYKLNDLEKRREVYE 246 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.0 bits (47), Expect = 3.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Query: 42 ANLLSQSKLNDLKESRNEYE 61 A L + KLNDL++ R YE Sbjct: 227 AETLKRYKLNDLEKRREVYE 246 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.8 bits (44), Expect = 7.8 Identities = 12/40 (30%), Positives = 18/40 (45%) Query: 27 NAADLKNASNIKLAAANLLSQSKLNDLKESRNEYEYEHNN 66 N D KN + L A Q+K + N +Y++NN Sbjct: 114 NKLDKKNDDSPALRALLTRPQAKKTPPNQYENFQQYDNNN 153 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 7.8 Identities = 9/28 (32%), Positives = 14/28 (50%) Query: 223 DHDYQVVKSLDTHKVLPNGYVDLPIDED 250 +H V S+ V NG+V+ +ED Sbjct: 1505 NHRNSVASSIPAKDVFENGHVNKAFEED 1532 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 7.8 Identities = 9/28 (32%), Positives = 14/28 (50%) Query: 223 DHDYQVVKSLDTHKVLPNGYVDLPIDED 250 +H V S+ V NG+V+ +ED Sbjct: 1505 NHRNSVASSIPAKDVFENGHVNKAFEED 1532 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 7.8 Identities = 9/28 (32%), Positives = 14/28 (50%) Query: 223 DHDYQVVKSLDTHKVLPNGYVDLPIDED 250 +H V S+ V NG+V+ +ED Sbjct: 1505 NHRNSVASSIPAKDVFENGHVNKAFEED 1532 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 7.8 Identities = 9/28 (32%), Positives = 14/28 (50%) Query: 223 DHDYQVVKSLDTHKVLPNGYVDLPIDED 250 +H V S+ V NG+V+ +ED Sbjct: 1505 NHRNSVASSIPAKDVFENGHVNKAFEED 1532 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 21.8 bits (44), Expect = 7.8 Identities = 12/40 (30%), Positives = 18/40 (45%) Query: 27 NAADLKNASNIKLAAANLLSQSKLNDLKESRNEYEYEHNN 66 N D KN + L A Q+K + N +Y++NN Sbjct: 114 NKLDKKNDDSPALRALLTRPQAKKTPPNQYENFQQYDNNN 153 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.313 0.133 0.372 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,587 Number of Sequences: 317 Number of extensions: 2826 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of query: 356 length of database: 114,650 effective HSP length: 58 effective length of query: 298 effective length of database: 96,264 effective search space: 28686672 effective search space used: 28686672 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -