BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA001459-TA|BGIBMGA001459-PA|undefined (51 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q24310 Cluster: Polyprotein; n=1; Drosophila melanogast... 42 0.003 UniRef50_A6RNP7 Cluster: Predicted protein; n=1; Botryotinia fuc... 30 7.7 >UniRef50_Q24310 Cluster: Polyprotein; n=1; Drosophila melanogaster|Rep: Polyprotein - Drosophila melanogaster (Fruit fly) Length = 1053 Score = 41.5 bits (93), Expect = 0.003 Identities = 20/40 (50%), Positives = 26/40 (65%) Query: 7 EEIVTSYVLAHVAQFDCRLHHMAFTNGNTTRNKLLQEIKA 46 EEI + VLAH+A D RL + FT+ TR+KL E+KA Sbjct: 144 EEIAVTTVLAHMANIDSRLQRVLFTSNVRTRSKLQAELKA 183 >UniRef50_A6RNP7 Cluster: Predicted protein; n=1; Botryotinia fuckeliana B05.10|Rep: Predicted protein - Botryotinia fuckeliana B05.10 Length = 245 Score = 30.3 bits (65), Expect = 7.7 Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Query: 2 EDLSHEEIVTSYVLAHVAQFDCRLHHMAFTNGNTTR--NKLL 41 + L HEE++ +++ H F+ H +F N NKLL Sbjct: 28 KSLGHEEVIEQHIIQHSTSFEITQHSTSFERQNVINWYNKLL 69 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.319 0.128 0.361 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,096,711 Number of Sequences: 1657284 Number of extensions: 1303928 Number of successful extensions: 2320 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2319 Number of HSP's gapped (non-prelim): 2 length of query: 51 length of database: 575,637,011 effective HSP length: 32 effective length of query: 19 effective length of database: 522,603,923 effective search space: 9929474537 effective search space used: 9929474537 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -